KEGG   Escherichia coli K-12 MG1655: b2160Help
Entry
b2160             CDS       T00007                                 

Gene name
yeiI
Definition
(RefSeq) putative kinase
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB HTH_24 HTH_11 MarR_2 HTH_AsnC-type HTH_Crp_2 Sigma70_r4 MarR GerE PCI HTH_5 PLU-1 Arg_repressor TrmB
Motif
Other DBs
NCBI-GeneID: 946640
NCBI-ProteinID: NP_416665
Pasteur: yeiI
RegulonDB: ECK120001945
ECOCYC: EG12028
ASAP: ABE-0007149
UniProt: P33020
Position
2251700..2252788
Genome map
AA seq 362 aa AA seqDB search
MNNREKEILAILRRNPLIQQNEIADMLQISRSRVAAHIMDLMRKGRIKGKGYILTEQEYC
VVVGTINMDIRGMADIRYPQSASHPGTIHCSAGGVGRNIAHNLALLGRDVHLLSVIGDDF
YGEMLLEETRRAGVNVSGCVRLHGQSTSTYLAIANRDDQTVLAINDTHLLEQLTPQLLNG
SRDLLRHAGVVLADCNLTAEALEWVFTLADEIPVFVDTVSEFKAGKIKHWLAHIHTLKPT
LPELEILWGQAITSDADRNTAVNALHQQGVQQLFVYLPDESVYCSEKDGEQFLLTAPAHT
TVDSFGADDGFMAGLVYSFLEGYSFRDSARFAVACAAISRASGSLNNPTLSADNALSLVP
MV
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaataaccgggaaaaggagatccttgcaattttacggcgtaacccgctgattcagcag
aacgaaattgcggacatgctgcaaatcagccgttcgcgcgttgcggcgcatattatggat
ttaatgcgcaaaggccggattaaaggcaaaggttacattctcaccgagcaggaatactgc
gtagtggtggggacaatcaatatggatattcgcgggatggcggatatccgttacccgcaa
tcggcttctcatcccggtacaattcattgctcagcgggcggcgtgggacgcaacatcgcc
cacaatctggcgctgttaggccgtgacgtccatttgctttcagtgattggcgatgacttt
tatggcgaaatgctcctggaagaaacgcgccgtgccggcgtgaatgtctccggctgcgtt
cgtttgcatggtcaaagcacatcgacgtatctggcaattgccaatcgagacgatcaaacc
gtgctggcgattaacgatacccatctgctggaacagttgacaccgcaactactgaacggg
tcgcgcgatttacttcgtcatgcgggcgtggtactggctgattgcaacctgacagccgag
gcgctggaatgggtctttaccctcgctgatgaaatcccggtgtttgtcgataccgtttca
gaattcaaagcgggcaaaatcaaacactggctggcgcatattcacaccctgaaacccact
ttaccggagctggaaattttatggggacaggcgatcaccagcgatgctgaccgtaatacc
gcagtgaatgcattgcatcagcaaggtgttcagcaactgtttgtttatttgcccgatgag
tcagtttattgcagcgaaaaggatggagaacaatttttgctgaccgcgccagcgcatacg
acagtagacagttttggtgctgacgatggttttatggcgggcctggtatatagctttctt
gaaggatacagtttccgcgacagcgcccgttttgcggtagcctgcgcggcaatttcgcgc
gccagcggcagcttaaacaaccctaccctgtctgccgataacgcgctttcattagtgcca
atggtgtaa

DBGET integrated database retrieval system