KEGG   Escherichia coli K-12 MG1655: b2164Help
Entry
b2164             CDS       T00007                                 

Gene name
psuT
Definition
(RefSeq) putative nucleoside transporter
  KO
K16324  
putative pseudouridine transporter
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b2164 (psuT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(2256085..2257335)
Genome map
AA seq 416 aa AA seqDB search
MDIMRSVVGMVVLLAIAFLLSVNKKSISLRTVGAALLLQIAIGGIMLYFPPGKWAVEQAA
LGVHKVMSYSDAGSAFIFGSLVGPKMDVLFDGAGFIFAFRVLPAIIFVTALISLLYYIGV
MGLLIRILGSIFQKALNISKIESFVAVTTIFLGQNEIPAIVKPFIDRMNRNELFTAICSG
MASIAGSMMIGYAGMGVPIDYLLAASLMAIPGGILFARILSPATEPSQVTFENLSFSETP
PKSFIEAAASGAMTGLKIAAGVATVVMAFVAIIALINGIIGGIGGWFGFANASLESIFGY
VLAPLAWIMGVDWSDANLAGSLIGQKLAINEFVAYLSFSPYLQTGGTLEVKTIAIISFAL
CGFANFGSIGVVVGAFSAISPKRAPEIAQLGLRALAAATLSNLMSATIAGFFIGLA
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggatataatgagaagtgttgtggggatggtggtgttactggcaatagcatttctgttg
tcagtgaataaaaagagcatcagtttgcgcacggttggagccgcactgctgctgcaaatc
gctattggtggcatcatgctctacttcccaccgggaaaatgggcagtagaacaggcggca
ttaggcgttcataaagtgatgtcttacagtgatgccggtagcgccttcatttttggttcg
ctggttgggccgaaaatggatgtcctgtttgacggtgcgggttttatcttcgcctttcgc
gtacttccggcgattattttcgttactgcgctcatcagtctgctgtactacattggcgtg
atggggctgctgattcgcatccttggcagcattttccagaaagccctcaacatcagcaaa
atcgaatcttttgttgcggttactactattttcctcgggcaaaatgagatcccggcgatc
gttaaaccgtttatcgatcgcatgaatcgcaacgagttgtttaccgcaatttgtagcggg
atggcgtccattgctggttcgatgatgattggttatgccggaatgggcgtaccaattgac
tacctgttagcggcatcgctgatggcgatccctggcgggattttgtttgcacgtattctt
agcccggcaaccgagccttcgcaggtcacatttgaaaatctgtcgttcagcgaaacgccg
ccaaaaagctttatcgaagcggcggcgagcggtgcgatgaccgggctaaaaatcgccgct
ggtgtggcgacggtggtaatggcgtttgtcgcaattattgcgctgatcaacggcattatc
ggcggaattggcggctggtttggtttcgccaatgcctctctggaaagtatttttggctat
gtgctggcaccgctggcgtggatcatgggtgtggactggagtgatgccaatcttgcgggt
agcctgattgggcagaaactggcgattaacgaattcgtcgcttacctgagtttctcccca
tacctgcaaacgggcggcacgctggaagtgaaaaccattgcgattatctcctttgcgctt
tgtggttttgctaactttggttctatcggtgttgtcgttggcgcattttcggctatttcg
ccaaaacgcgcgccggaaatcgcccagcttggtttacgggcgctggcagcagcaacgctt
tccaacctgatgagtgcgactattgccgggttctttattggtctggcgtaa

DBGET integrated database retrieval system