KEGG   Escherichia coli K-12 MG1655: b2167Help
Entry
b2167             CDS       T00007                                 

Gene name
fruA
Definition
fused fructose-specific PTS enzymes: IIBcomponent/IIC components
Orthology
K02769  
PTS system, fructose-specific IIB component [EC:2.7.1.69]
K02770  
PTS system, fructose-specific IIC component
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Fructose and mannose metabolism
Metabolic pathways
Phosphotransferase system (PTS)
Module
PTS system, fructose-specific II component
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:eco00051]
Environmental Information Processing; Membrane transport; Phosphotransferase system (PTS) [PATH:eco02060]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(2259719..2261410)
Genome map
AA seq 563 aa AA seqDB search
MKTLLIIDANLGQARAYMAKTLLGAAARKAKLEIIDNPNDAEMAIVLGDSIPNDSALNGK
NVWLGDISRAVAHPELFLSEAKGHAKPYTAPVAATAPVAASGPKRVVAVTACPTGVAHTF
MAAEAIETEAKKRGWWVKVETRGSVGAGNAITPEEVAAADLVIVAADIEVDLAKFAGKPM
YRTSTGLALKKTAQELDKAVAEATPYEPAGKAQTATTESKKESAGAYRHLLTGVSYMLPM
VVAGGLCIALSFAFGIEAFKEPGTLAAALMQIGGGSAFALMVPVLAGYIAFSIADRPGLT
PGLIGGMLAVSTGSGFIGGIIAGFLAGYIAKLISTQLKLPQSMEALKPILIIPLISSLVV
GLAMIYLIGKPVAGILEGLTHWLQTMGTANAVLLGAILGGMMCTDMGGPVNKAAYAFGVG
LLSTQTYGPMAAIMAAGMVPPLAMGLATMVARRKFDKAQQEGGKAALVLGLCFISEGAIP
FAARDPMRVLPCCIVGGALTGAISMAIGAKLMAPHGGLFVLLIPGAITPVLGYLVAIIAG
TLVAGLAYAFLKRPEVDAVAKAA
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgctgctgattattgacgctaatctcggtcaggcacgcgcctatatggcgaag
accctgctgggcgcggcggcgcgaaaagcaaaactggaaatcatcgacaatccgaacgac
gctgaaatggcgattgttctcggtgattccatcccgaacgacagcgcgctgaacggtaaa
aatgtctggctgggcgatatttcccgggcagttgcgcaccctgagctgttcctgagtgaa
gccaaaggccatgcgaaaccttacactgcgccggtcgctgcgacagcaccagttgccgcc
agcggtccgaaacgcgtagttgcggtgactgcttgcccgactggcgtagcacacaccttt
atggcggctgaagccattgaaaccgaagcgaaaaaacgtggctggtgggtgaaagttgaa
acccgtggttctgttggcgcgggtaatgcaatcactcccgaagaagtcgcagcagcggat
ctggtgattgtggcggcagatatcgaagtggatctggcgaaatttgctggtaaaccgatg
tatcgtacctctaccggtctggcgctgaagaaaaccgcgcaggaactggataaagcggtt
gctgaagcaacgccgtatgaaccggcgggcaaagctcaaacggcgaccactgaaagtaag
aaagagagtgcaggcgcataccgtcacttgctgacgggcgtttcttacatgctgccgatg
gtcgttgcaggtggtctgtgtatcgcgctttcttttgcttttggtatcgaagcgtttaaa
gagccgggtacgttggctgcggcgctgatgcagattggtggtggttcagcctttgcgctg
atggtgccggtactggcaggttatattgccttttccattgccgatcgtccgggcctcact
ccgggtctgattggcggtatgctggcggtcagcaccggttctggcttcattggtggtatt
attgcgggcttcctggctggttacattgcgaagttaatcagtacgcaattgaaactgcca
cagagtatggaggcgctgaaaccgatcctgatcattccgctaatttccagtctggtggtc
ggtctggcgatgatctacctgatcggtaaaccagttgctggcattctcgaagggctgact
cactggctgcagaccatggggactgcgaatgcggttctgctgggggcgatcctcggtggc
atgatgtgtactgacatgggcggtccggtaaacaaagcagcgtacgcattcggtgtgggt
ctgctgagtactcaaacctatggcccgatggcggcgattatggcggcaggtatggtgcca
ccgctggcaatgggtctggcaacaatggtggcgcgtcgcaaattcgacaaagcgcagcag
gaaggtggcaaagccgctctggtattgggactgtgcttcatttcggaaggtgcaattccg
tttgctgctcgtgatccgatgcgtgtgctgccgtgctgtatcgtgggtggggcgctgact
ggcgcaatctcaatggcgattggtgcgaaactgatggcaccgcacggtggtctgtttgtt
ctgctgatccctggcgctattacgccggtattgggttacctggtagcaattattgccggt
acgctggtggcgggtttggcctatgccttcctgaaacgtccggaagtggacgcagtagcg
aaagcagcgtaa

DBGET integrated database retrieval system