KEGG   Escherichia coli K-12 MG1655: b2178Help
Entry
b2178             CDS       T00007                                 

Gene name
yejB
Definition
(RefSeq) microcin C transporter YejABEF, permease subunit; ABC family
  KO
K13894  
microcin C transport system permease protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
ABC transporters
Module
Microcin C transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b2178 (yejB)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Microcin C transporter [MD:M00349] [OT]
    b2178 (yejB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
2274179..2275273
Genome map
AA seq 364 aa AA seqDB search
MGAYLIRRLLLVIPTLWAIITINFFIVQIAPGGPVDQAIAAIEFGNAGVLPGAGGEGVRA
SHAQTGVGNISDSNYRGGRGLDPEVIAEITHRYGFDKPIHERYFKMLWDYIRFDFGDSLF
RSASVLTLIKDSLPVSITLGLWSTLIIYLVSIPLGIRKAVYNGSRFDVWSSAFIIIGYAI
PAFLFAILLIVFFAGGSYFDLFPLRGLVSANFDSLPWYQKITDYLWHITLPVLATVIGGF
AALTMLTKNSFLDEVRKQYVVTARAKGVSEKNILWKHVFRNAMLLVIAGFPATFISMFFT
GSLLIEVMFSLNGLGLLGYEATVSRDYPVMFGTLYIFTLIGLLLNIVSDISYTLVDPRID
FEGR
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcttacctgattcgccgtctgttgctggtgatcccaacattatgggcgattatc
accatcaactttttcatcgtgcaaattgcgcctggcggtccggtcgaccaggccatcgcc
gccattgagtttggtaatgccggagtattacccggcgcaggcggtgaaggtgttcgtgcc
agccatgcgcaaacgggtgtcggcaatatcagcgacagtaattaccgtggcggacgcgga
ttagatccagaagtgatcgctgagatcactcatcgctacggttttgataagccgatccac
gaacgttacttcaaaatgctctgggactacatccgctttgattttggcgatagcctgttt
cgcagcgcctcggtgctgacgctgattaaagacagtctgccggtttccatcaccctcgga
ttgtggagcacgctgattatctatctggtgtcgattccgttaggcattcgcaaagctgtt
tataatgggagccgctttgacgtctggagtagcgcatttatcatcatcggctacgccatt
ccggcctttttgtttgccatcctgctgattgtcttcttcgcgggcggcagctatttcgac
ctgttccctctacgcggcctggtttccgctaactttgattcgctgccgtggtatcagaaa
atcaccgattatctgtggcatatcacgctgccggtgctggcgacagtgattggtggcttt
gcggcgctgaccatgctgacaaaaaactcattccttgatgaagtgcgcaagcaatacgtg
gtgaccgcgcgtgcgaaaggggtaagtgaaaaaaatattctctggaaacatgtgttccgc
aacgccatgctgctggtgattgccggttttccggcgacgtttatcagcatgttttttacc
ggctcgctgctgattgaggtgatgttttcactcaatggtctgggcttactgggctacgaa
gcgaccgtctcgcgcgattatcctgtaatgtttggtaccttgtatattttcaccctgatt
ggcctgctgctgaatattgtcagtgatatcagctatacgctggttgatccgcgtattgat
tttgagggacgttaa

DBGET integrated database retrieval system