KEGG   Escherichia coli K-12 MG1655: b2179Help
Entry
b2179             CDS       T00007                                 

Gene name
yejE
Definition
(RefSeq) microcin C transporter YejABEF, permease subunit; ABC family
  KO
K13895  
microcin C transport system permease protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
ABC transporters
Module
Microcin C transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b2179 (yejE)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Microcin C transporter [MD:M00349] [OT]
    b2179 (yejE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
2275273..2276298
Genome map
AA seq 341 aa AA seqDB search
MSRLSPVNQARWARFRHNRRGYWSLWIFLVLFGLSLCSELIANDKPLLVRYDGSWYFPLL
KNYSESDFGGPLASQADYQDPWLKQRLENNGWVLWAPIRFGATSINFATNKPFPSPPSRQ
NWLGTDANGGDVLARILYGTRISVLFGLMLTLCSSVMGVLAGALQGYYGGKVDLWGQRFI
EVWSGMPTLFLIILLSSVVQPNFWWLLAITVLFGWMSLVGVVRAEFLRTRNFDYIRAAQA
LGVSDRSIILRHMLPNAMVATLTFLPFILCSSITTLTSLDFLGFGLPLGSPSLGELLLQG
KNNLQAPWLGITAFLSVAILLSLLIFIGEAVRDAFDPNKAV
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgactcagccccgtcaatcaggcccgttgggcgcgttttcgtcataaccgtcgc
ggctactggtcgttatggattttcctcgtcttgtttggtttgagtttgtgttctgaactt
atcgccaacgataaaccgttgctggtgcgttatgacggcagttggtatttcccgttattg
aaaaactacagcgaaagcgattttggcggcccgctggcaagtcaggctgattatcaggac
ccgtggctgaaacaacggctggaaaataacggctgggtactgtgggcaccgattcgcttt
ggtgctaccagtatcaactttgctaccaataagcccttcccttctccaccctcccggcaa
aactggctgggaacggatgccaacggcggcgatgtgctggcacgcattctctatggcacg
cggatctcggttctgtttggcctgatgctgactctctgttccagcgtgatgggcgtgctg
gcgggggcgctacaaggctattacggcggtaaagtcgatctctggggacaacgctttatt
gaagtatggtcggggatgccgacgctgtttttgattattttactttccagcgtcgtacag
cctaacttctggtggctgctggcaattactgtcttgtttggctggatgagtctggtcggc
gtggtgcgggcggagtttttacgtactcgtaatttcgactacattcgtgcggcacaggcg
cttggcgtcagcgatcgcagtatcatcctgcgtcatatgttgcctaatgccatggtcgcg
accctcacctttttaccgtttattttatgtagttcgataaccaccctgacctcgctcgat
ttcctcggcttcggtctaccgctcggttcaccgtcactcggtgaactgctgttacaaggg
aaaaataaccttcaggccccgtggcttgggatcaccgccttcttgtcggtggcgatatta
ttgtctttgctgatctttattggtgaagccgtccgcgacgcatttgatcctaataaggcg
gtgtag

DBGET integrated database retrieval system