KEGG   Escherichia coli K-12 MG1655: b2180Help
Entry
b2180             CDS       T00007                                 

Gene name
yejF
Definition
(RefSeq) microcin C transporter, ATP-binding subunit; ABC family
  KO
K13896  
microcin C transport system ATP-binding protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
ABC transporters
Module
Microcin C transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b2180 (yejF)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Microcin C transporter [MD:M00349] [OT]
    b2180 (yejF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
2276300..2277889
Genome map
AA seq 529 aa AA seqDB search
MTQTLLAIENLSVGFRHQQTVRTVVNDVSLQIEAGETLALVGESGSGKSVTALSILRLLP
SPPVEYLSGDIRFHGESLLHASDQTLRGVRGNKIAMIFQEPMVSLNPLHTLEKQLYEVLS
LHRGMRREAARGEILNCLDRVGIRQAAKRLTDYPHQLSGGERQRVMIAMALLTRPELLIA
DEPTTALDVSVQAQILQLLRELQGELNMGMLFITHNLSIVRKLAHRVAVMQNGRCVEQNY
AATLFASPTHPYTQKLLNSEPSGDPVPLPEPASTLLDVEQLQVAFPIRKGILKRIVDHNV
VVKNISFTLRAGETLGLVGESGSGKSTTGLALLRLINSQGSIIFDGQPLQNLNRRQLLPI
RHRIQVVFQDPNSSLNPRLNVLQIIEEGLRVHQPTLSAAQREQQVIAVMHEVGLDPETRH
RYPAEFSGGQRQRIAIARALILKPSLIILDEPTSSLDKTVQAQILTLLKSLQQKHQLAYL
FISHDLHVVRALCHQVIILRQGEVVEQGPCARVFATPQQEYTRQLLALS
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaaactctgttagcgattgaaaatttgtcggtgggttttcgccatcagcaaacc
gtacgtacagtagtcaatgatgtttcactacagattgaggctggcgaaacgctggcgctg
gtgggtgagtcaggttcaggcaaaagcgttaccgcgctgtcaattttacgcctgctccct
tccccgccggttgaatatctctccggcgatattcgttttcatggcgaatcgctgcttcac
gccagcgatcaaacgttgcgcggtgtacgcggtaataagatcgccatgatttttcaggaa
ccgatggtgtcgttaaatccattgcataccctggaaaaacagctttatgaagtgctttca
ctccaccgcgggatgcgtcgggaagcggctcgtggcgaaattcttaactgccttgatcgc
gttggtatccgccaggcggcaaaacggctgacagattatccgcatcagctctccggcggc
gaacggcagcgggtgatgattgcgatggcgctgttaacgcgaccggaattattaattgcc
gatgaaccgaccaccgcactggacgtctctgtccaggcgcagattttacagctgttgcgc
gaactgcaaggcgagctgaatatgggcatgctgtttattactcataacctcagcattgtc
agaaaactggcccaccgcgtggcggtaatgcaaaacggtcgctgtgtcgagcaaaattac
gccgctacgctatttgcatcacccactcatccttacacacaaaagctactcaacagtgaa
ccgtcaggcgatccagtgccgttgccagaacctgcctcaacgttgctggatgttgaacag
cttcaggttgccttccccattcgcaaagggattttgaagcgcattgtggatcataatgtg
gtggtgaaaaacatcagttttacgctacgagcgggtgaaacactgggtttagtgggcgag
tccggttccgggaaaagtacgacgggactggcgctgctgcgactgattaattctcagggc
agcatcatctttgacggtcagccactgcaaaatttaaatcgccgccagctgttacctatt
cgtcatcgcattcaggtggtatttcaggatccaaactcctcgctcaacccacgactcaac
gttttgcagattattgaggaaggcttacgggttcaccagccgacgctttctgccgcacaa
cgcgaacaacaagtgatagccgtgatgcatgaagtgggattagatcctgaaacacgccac
cgttatccggcggagttctctggtggtcagcgacaacgtattgcgattgccagggcatta
attcttaagccctcgctgatcatacttgatgaaccgacatcatcactcgacaaaacggta
caggcgcaaatattgacgctattgaaatcattgcaacaaaagcatcaactggcctatttg
tttatcagccacgatttgcacgttgtccgcgcgttatgtcatcaggttatcatactgcga
caaggggaagtagtggaacaaggaccgtgcgcgcgcgtgtttgccacaccgcagcaggag
tatacgcgtcagctactggcgttgagctga

DBGET integrated database retrieval system