KEGG   Escherichia coli K-12 MG1655: b2211Help
Entry
b2211             CDS       T00007                                 

Gene name
yojI
Definition
(RefSeq) microcin J25 efflux pump, TolC-dependent; fused ABC transporter permease and ATP-binding components
  KO
K06159  
putative ATP-binding cassette transporter
Organism
eco  Escherichia coli K-12 MG1655
Pathway
ABC transporters
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b2211 (yojI)
Transporters [BR:eco02000]
 ABC Transporters, Eukaryotic Type
  Other subfamilies
   Other putative ABC transporters
    b2211 (yojI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(2306972..2308615)
Genome map
AA seq 547 aa AA seqDB search
MELLVLVWRQYRWPFISVMALSLASAALGIGLIAFINQRLIETADTSLLVLPEFLGLLLL
LMAVTLGSQLALTTLGHHFVYRLRSEFIKRILDTHVERIEQLGSASLLAGLTSDVRNITI
AFVRLPELVQGIILTIGSAAYLWMLSGKMLLVTAIWMAITIWGGFVLVARVYKHMATLRE
TEDKLYTDFQTVLEGRKELTLNRERAEYVFNNLYIPDAQEYRHHIIRADTFHLSAVNWSN
IMMLGAIGLVFWMANSLGWADTNVAATYSLTLLFLRTPLLSAVGALPTLLTAQVAFNKLN
KFALAPFKAEFPRPQAFPNWQTLELRNVTFAYQDNAFSVGPINLTIKRGELLFLIGGNGS
GKSTLAMLLTGLYQPQSGEILLDGKPVSGEQPEDYRKLFSAVFTDVWLFDQLLGPEGKPA
NPQLVEKWLAQLKMAHKLELSNGRIVNLKLSKGQKKRVALLLALAEERDIILLDEWAADQ
DPHFRREFYQVLLPLMQEMGKTIFAISHDDHYFIHADRLLEMRNGQLSELTGEERDAASR
DAVARTA
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggaacttcttgtacttgtctggcggcagtatcgctggccatttatcagtgtgatggcg
ctaagcctcgccagtgcggcattaggcattggcttaattgcttttatcaatcagcgcctt
atcgaaacggcggataccagtctgctggtgttgccggagtttctgggattattgctgctg
ttgatggcagtcactctcggatcgcaactggcgctcaccactttggggcatcacttcgtt
taccgactgcgtagtgaatttatcaagcggattctggatactcacgtcgagcgcattgaa
caactcggtagcgcctcgttgctggcggggttaaccagcgatgtgcgcaatatcaccatt
gcttttgtgcgtctgccggaactggtgcaggggatcattctcactatcggttcagcggcg
tatctgtggatgctgtcgggcaaaatgttgctggtaacggctatctggatggcgatcacc
atctggggcggttttgtgctggtggcgcgggtgtacaaacatatggcgaccctgcgtgaa
accgaagacaagctgtacacggattttcaaactgtacttgaagggcgcaaagagctgact
ctgaaccgggaacgcgccgagtatgtgtttaacaacctctacattcctgatgcgcaagag
tatcgccaccatattattcgcgcagacaccttccatcttagtgccgtgaactggtcaaac
atcatgatgctgggcgcaatcggcctggtgttctggatggcgaacagcctcggttgggct
gataccaacgttgccgcgacctattcgttgacgcttttattcctgcgtacgccgctgctt
tcggcggttggcgcattgccgacgctgctgacggcgcaggtggcgtttaacaagctgaac
aaattcgcgctcgcgcctttcaaagcagagtttccgcgcccgcaggcgtttcccaactgg
caaacgctggagctgcgtaacgtgacgtttgcttatcaggataacgcgttttccgttggt
ccgattaatctcaccatcaaacgtggcgagctgctgtttctgattggcggcaacggtagc
ggaaaatcgacgctggcgatgttgttgacgggcttgtatcagccacaaagcggcgaaatc
ttgctggatggcaaacctgtcagcggcgaacaaccggaagattatcgcaaactgttttcg
gcagtgtttaccgatgtctggctgtttgatcaactgctggggccggagggtaaacccgct
aacccgcaactggttgagaagtggctggcgcagctgaaaatggctcataagcttgagtta
agcaacgggcgtattgttaacctgaagttatcaaaagggcagaaaaaacgcgtggcgctg
ttgctggcgctggcagaagaacgcgatattatcctgctggatgaatgggcggcggatcag
gatccacacttccgtcgtgagttttatcaggtgttgctgccgctgatgcaggagatgggt
aaaactattttcgctatcagtcatgatgatcattactttatccacgccgaccgcctgctg
gaaatgcgcaatgggcaacttagcgagctgacgggcgaagagcgcgatgccgcttcgcgt
gatgccgttgcccggacggcataa

DBGET integrated database retrieval system