KEGG   Escherichia coli K-12 MG1655: b2211Help
Entry
b2211             CDS       T00007                                 

Gene name
yojI
Definition
(RefSeq) microcin J25 efflux ABC transporter permease/ATPase
  KO
K06159  multidrug/microcin transport system ATP-binding/permease protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b2211 (yojI)
Transporters [BR:eco02000]
 ABC Transporters, Eukaryotic Type
  Other subfamilies
   Other ABC transporters
    b2211 (yojI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 ABC_membrane SMC_N AAA_16 AAA_15 AAA_29 Methyltransf_30 AAA_5 APS_kinase
Motif
Other DBs
NCBI-GeneID: 946705
NCBI-ProteinID: NP_416715
Pasteur: yojI
RegulonDB: ECK120001979
ECOCYC: EG12070
ASAP: ABE-0007303
UniProt: P33941
Position
complement(2306972..2308615)
Genome map
AA seq 547 aa AA seqDB search
MELLVLVWRQYRWPFISVMALSLASAALGIGLIAFINQRLIETADTSLLVLPEFLGLLLL
LMAVTLGSQLALTTLGHHFVYRLRSEFIKRILDTHVERIEQLGSASLLAGLTSDVRNITI
AFVRLPELVQGIILTIGSAAYLWMLSGKMLLVTAIWMAITIWGGFVLVARVYKHMATLRE
TEDKLYTDFQTVLEGRKELTLNRERAEYVFNNLYIPDAQEYRHHIIRADTFHLSAVNWSN
IMMLGAIGLVFWMANSLGWADTNVAATYSLTLLFLRTPLLSAVGALPTLLTAQVAFNKLN
KFALAPFKAEFPRPQAFPNWQTLELRNVTFAYQDNAFSVGPINLTIKRGELLFLIGGNGS
GKSTLAMLLTGLYQPQSGEILLDGKPVSGEQPEDYRKLFSAVFTDVWLFDQLLGPEGKPA
NPQLVEKWLAQLKMAHKLELSNGRIVNLKLSKGQKKRVALLLALAEERDIILLDEWAADQ
DPHFRREFYQVLLPLMQEMGKTIFAISHDDHYFIHADRLLEMRNGQLSELTGEERDAASR
DAVARTA
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggaacttcttgtacttgtctggcggcagtatcgctggccatttatcagtgtgatggcg
ctaagcctcgccagtgcggcattaggcattggcttaattgcttttatcaatcagcgcctt
atcgaaacggcggataccagtctgctggtgttgccggagtttctgggattattgctgctg
ttgatggcagtcactctcggatcgcaactggcgctcaccactttggggcatcacttcgtt
taccgactgcgtagtgaatttatcaagcggattctggatactcacgtcgagcgcattgaa
caactcggtagcgcctcgttgctggcggggttaaccagcgatgtgcgcaatatcaccatt
gcttttgtgcgtctgccggaactggtgcaggggatcattctcactatcggttcagcggcg
tatctgtggatgctgtcgggcaaaatgttgctggtaacggctatctggatggcgatcacc
atctggggcggttttgtgctggtggcgcgggtgtacaaacatatggcgaccctgcgtgaa
accgaagacaagctgtacacggattttcaaactgtacttgaagggcgcaaagagctgact
ctgaaccgggaacgcgccgagtatgtgtttaacaacctctacattcctgatgcgcaagag
tatcgccaccatattattcgcgcagacaccttccatcttagtgccgtgaactggtcaaac
atcatgatgctgggcgcaatcggcctggtgttctggatggcgaacagcctcggttgggct
gataccaacgttgccgcgacctattcgttgacgcttttattcctgcgtacgccgctgctt
tcggcggttggcgcattgccgacgctgctgacggcgcaggtggcgtttaacaagctgaac
aaattcgcgctcgcgcctttcaaagcagagtttccgcgcccgcaggcgtttcccaactgg
caaacgctggagctgcgtaacgtgacgtttgcttatcaggataacgcgttttccgttggt
ccgattaatctcaccatcaaacgtggcgagctgctgtttctgattggcggcaacggtagc
ggaaaatcgacgctggcgatgttgttgacgggcttgtatcagccacaaagcggcgaaatc
ttgctggatggcaaacctgtcagcggcgaacaaccggaagattatcgcaaactgttttcg
gcagtgtttaccgatgtctggctgtttgatcaactgctggggccggagggtaaacccgct
aacccgcaactggttgagaagtggctggcgcagctgaaaatggctcataagcttgagtta
agcaacgggcgtattgttaacctgaagttatcaaaagggcagaaaaaacgcgtggcgctg
ttgctggcgctggcagaagaacgcgatattatcctgctggatgaatgggcggcggatcag
gatccacacttccgtcgtgagttttatcaggtgttgctgccgctgatgcaggagatgggt
aaaactattttcgctatcagtcatgatgatcattactttatccacgccgaccgcctgctg
gaaatgcgcaatgggcaacttagcgagctgacgggcgaagagcgcgatgccgcttcgcgt
gatgccgttgcccggacggcataa

DBGET integrated database retrieval system