KEGG   Escherichia coli K-12 MG1655: b2212Help
Entry
b2212             CDS       T00007                                 

Gene name
alkB
Definition
(RefSeq) oxidative demethylase of N1-methyladenine or N3-methylcytosine DNA lesions
  KO
K03919  
alkylated DNA repair protein (DNA oxidative demethylase) [EC:1.14.11.33]
Organism
eco  Escherichia coli K-12 MG1655
Brite
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.33  DNA oxidative demethylase
     b2212 (alkB)
DNA repair and recombination proteins [BR:eco03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   Direct repair
    b2212 (alkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2308691..2309341)
Genome map
AA seq 216 aa AA seqDB search
MLDLFADAEPWQEPLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVA
MTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLIN
RYAPGAKLSLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGG
ESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGKKE
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgttggatctgtttgccgatgctgaaccgtggcaagagccactggcggctggtgcggta
attttacggcgttttgcttttaacgctgcggagcaactgatccgcgatattaatgacgtt
gccagccagtcgccgtttcgccagatggtcacccccgggggatataccatgtcggtggcg
atgaccaactgtgggcatctgggctggacgacccatcggcaaggttatctctattcgccc
attgatccgcaaacaaataaaccgtggcccgccatgccacagagttttcataatttatgt
caacgtgcggctacggcggcgggctatccagatttccagccagatgcttgtcttatcaac
cgctacgctcctggcgcgaaactgtcgctgcatcaggataaagacgaaccggatctgcgc
gcgccaattgtttctgtttctctgggcttacccgcgatttttcaatttggcggcctgaaa
cgaaatgatccgctcaaacgtttgttgttggaacatggcgatgtggtggtatggggcggt
gaatcgcggctgttttatcacggtattcaaccgttgaaagcggggtttcatccactcacc
atcgactgccgctacaacctgacattccgtcaggcaggtaaaaaagaataa

DBGET integrated database retrieval system