KEGG   Escherichia coli K-12 MG1655: b2215Help
Entry
b2215             CDS       T00007                                 

Gene name
ompC
Definition
(RefSeq) outer membrane porin protein C
  KO
K09475  
outer membrane pore protein C
Organism
eco  Escherichia coli K-12 MG1655
Pathway
beta-Lactam resistance
Two-component system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    b2215 (ompC)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    b2215 (ompC)
Transporters [BR:eco02000]
 Other Transporters
  Pores ion channels [TC:1]
   b2215 (ompC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2311646..2312749)
Genome map
AA seq 367 aa AA seqDB search
MKVKVLSLLVPALLVAGAANAAEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLG
FKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYD
VTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGE
GFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAE
TYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQ
SKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVA
LGLVYQF
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttaaagtactgtccctcctggtcccagctctgctggtagcaggcgcagcaaac
gctgctgaagtttacaacaaagacggcaacaaattagatctgtacggtaaagtagacggc
ctgcactatttctctgacaacaaagatgtagatggcgaccagacctacatgcgtcttggc
ttcaaaggtgaaactcaggttactgaccagctgaccggttacggccagtgggaatatcag
atccagggcaacagcgctgaaaacgaaaacaactcctggacccgtgtggcattcgcaggt
ctgaaattccaggatgtgggttctttcgactacggtcgtaactacggcgttgtttatgac
gtaacttcctggaccgacgtactgccagaattcggtggtgacacctacggttctgacaac
ttcatgcagcagcgtggtaacggcttcgcgacctaccgtaacactgacttcttcggtctg
gttgacggcctgaactttgctgttcagtaccagggtaaaaacggcaacccatctggtgaa
ggctttactagtggcgtaactaacaacggtcgtgacgcactgcgtcaaaacggcgacggc
gtcggcggttctatcacttatgattacgaaggtttcggtatcggtggtgcgatctccagc
tccaaacgtactgatgctcagaacaccgctgcttacatcggtaacggcgaccgtgctgaa
acctacactggtggtctgaaatacgacgctaacaacatctacctggctgctcagtacacc
cagacctacaacgcaactcgcgtaggttccctgggttgggcgaacaaagcacagaacttc
gaagctgttgctcagtaccagttcgacttcggtctgcgtccgtccctggcttacctgcag
tctaaaggtaaaaacctgggtcgtggctacgacgacgaagatatcctgaaatatgttgat
gttggtgctacctactacttcaacaaaaacatgtccacctacgttgactacaaaatcaac
ctgctggacgacaaccagttcactcgtgacgctggcatcaacactgataacatcgtagct
ctgggtctggtttaccagttctaa

DBGET integrated database retrieval system