KEGG   Escherichia coli K-12 MG1655: b2225Help
Entry
b2225             CDS       T00007                                 

Gene name
yfaP
Definition
(RefSeq) DUF2135 family protein, putative host defense protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2135
Motif
Other DBs
NCBI-GeneID: 946728
NCBI-ProteinID: NP_416729
Pasteur: yfaP
RegulonDB: ECK120003729
ECOCYC: G7152
ASAP: ABE-0007357
UniProt: P76462
Position
complement(2327367..2328143)
Genome map
AA seq 258 aa AA seqDB search
MRKIFLPLLLVALSPVAHSEGVQEVEIDAPLSGWHPAEGEDASFSQSINYPASSVNMADD
QNISAQIRGKIKNYAAAGKVQQGRLVVNGASMPQRIESDGSFARPYIFTEGSNSVQVISP
DGQSRQKMQFYSTPGTGTIRARLRLVLSWDTDNTDLDLHVVTPDGEHAWYGNTVLKNSGA
LDMDVTTGYGPEIFAMPAPIHGRYQVYINYYGGRSETELTTAQLTLITDEGSVNEKQETF
IVPMRNAGELTLVKSFDW
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaagatttttcttccgttgttactggtggcgctttcgcctgtcgctcacagtgaa
ggtgtgcaggaagtcgagattgatgcaccgctctcaggctggcatccggcagagggcgaa
gatgccagtttttcacaatcgatcaattacccggcgtcgtccgtcaacatggcagatgat
caaaatatctcagcgcagatccgcggcaaaataaagaattatgctgcggcgggtaaagtt
cagcagggccggctggtggtcaacggtgccagtatgccgcagagaattgaatccgatggt
tcatttgcacgcccttatattttcactgaaggcagcaacagcgtgcaggtcatcagcccg
gatgggcaaagccgacaaaaaatgcagttttactcaacgccgggtacaggaacgattcgt
gcacgtttacggctggttctctcgtgggatacggacaataccgacctcgaccttcacgtt
gttacgcccgatggcgaacacgcctggtacggtaacaccgtgctgaaaaacagtggtgca
ctggatatggatgtcacgacggggtacggacccgagattttcgccatgcccgcgccaatt
cacgggcgctatcaggtgtatatcaactactatggtgggcgcagcgaaacggaattaacc
accgcccaactgacgctgatcaccgatgaaggatcggtcaatgagaaacaggaaacattt
attgtaccgatgcgtaatgctggcgagctgacgctggtgaaaagttttgactggtga

DBGET integrated database retrieval system