KEGG   Escherichia coli K-12 MG1655: b2231Help
Entry
b2231             CDS       T00007                                 

Gene name
gyrA
Definition
(RefSeq) DNA gyrase (type II topoisomerase), subunit A (EC:5.99.1.3)
  KO
K02469  
DNA gyrase subunit A [EC:5.99.1.3]
Organism
eco  Escherichia coli K-12 MG1655
Brite
Enzymes [BR:eco01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.3  DNA topoisomerase (ATP-hydrolysing)
     b2231 (gyrA)
DNA replication proteins [BR:eco03032]
 Prokaryotic Type
  DNA Topoisomerases
   b2231 (gyrA)
DNA repair and recombination proteins [BR:eco03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Facilitator
      b2231 (gyrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2336793..2339420)
Genome map
AA seq 875 aa AA seqDB search
MSDLAREITPVNIEEELKSSYLDYAMSVIVGRALPDVRDGLKPVHRRVLYAMNVLGNDWN
KAYKKSARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYMLVDGQGNFGSIDGDSAAAM
RYTEIRLAKIAHELMADLEKETVDFVDNYDGTEKIPDVMPTKIPNLLVNGSSGIAVGMAT
NIPPHNLTEVINGCLAYIDDEDISIEGLMEHIPGPDFPTAAIINGRRGIEEAYRTGRGKV
YIRARAEVEVDAKTGRETIIVHEIPYQVNKARLIEKIAELVKEKRVEGISALRDESDKDG
MRIVIEVKRDAVGEVVLNNLYSQTQLQVSFGINMVALHHGQPKIMNLKDIIAAFVRHRRE
VVTRRTIFELRKARDRAHILEALAVALANIDPIIELIRHAPTPAEAKTALVANPWQLGNV
AAMLERAGDDAARPEWLEPEFGVRDGLYYLTEQQAQAILDLRLQKLTGLEHEKLLDEYKE
LLDQIAELLRILGSADRLMEVIREELELVREQFGDKRRTEITANSADINLEDLITQEDVV
VTLSHQGYVKYQPLSEYEAQRRGGKGKSAARIKEEDFIDRLLVANTHDHILCFSSRGRVY
SMKVYQLPEATRGARGRPIVNLLPLEQDERITAILPVTEFEEGVKVFMATANGTVKKTVL
TEFNRLRTAGKVAIKLVDGDELIGVDLTSGEDEVMLFSAEGKVVRFKESSVRAMGCNTTG
VRGIRLGEGDKVVSLIVPRGDGAILTATQNGYGKRTAVAEYPTKSRATKGVISIKVTERN
GLVVGAVQVDDCDQIMMITDAGTLVRTRVSEISIVGRNTQGVILIRTAEDENVVGLQRVA
EPVDEEDLDTIDGSAAEGDDEIAPEVDVDDEPEEE
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaccttgcgagagaaattacaccggtcaacattgaggaagagctgaagagctcc
tatctggattatgcgatgtcggtcattgttggccgtgcgctgccagatgtccgagatggc
ctgaagccggtacaccgtcgcgtactttacgccatgaacgtactaggcaatgactggaac
aaagcctataaaaaatctgcccgtgtcgttggtgacgtaatcggtaaataccatccccat
ggtgactcggcggtctatgacacgatcgtccgcatggcgcagccattctcgctgcgttat
atgctggtagacggtcagggtaacttcggttctatcgacggcgactctgcggcggcaatg
cgttatacggaaatccgtctggcgaaaattgcccatgaactgatggccgatctcgaaaaa
gagacggtcgatttcgttgataactatgacggcacggaaaaaattccggacgtcatgcca
accaaaattcctaacctgctggtgaacggttcttccggtatcgccgtaggtatggcaacc
aacatcccgccgcacaacctgacggaagtcatcaacggttgtctggcgtatattgatgat
gaagacatcagcattgaagggctgatggaacacatcccggggccggacttcccgacggcg
gcaatcattaacggtcgtcgcggtattgaagaagcttaccgtaccggtcgcggcaaggtg
tatatccgcgctcgcgcagaagtggaagttgacgccaaaaccggtcgtgaaaccattatc
gtccacgaaattccgtatcaggtaaacaaagcgcgcctgatcgagaagattgcggaactg
gtaaaagaaaaacgcgtggaaggcatcagcgcgctgcgtgacgagtctgacaaagacggt
atgcgcatcgtgattgaagtgaaacgcgatgcggtcggtgaagttgtgctcaacaacctc
tactcccagacccagttgcaggtttctttcggtatcaacatggtggcattgcaccatggt
cagccgaagatcatgaacctgaaagacatcatcgcggcgtttgttcgtcaccgccgtgaa
gtggtgacccgtcgtactattttcgaactgcgtaaagctcgcgatcgtgctcatatcctt
gaagcattagccgtggcgctggcgaacatcgacccgatcatcgaactgatccgtcatgcg
ccgacgcctgcagaagcgaaaactgcgctggttgctaatccgtggcagctgggcaacgtt
gccgcgatgctcgaacgtgctggcgacgatgctgcgcgtccggaatggctggagccagag
ttcggcgtgcgtgatggtctgtactacctgaccgaacagcaagctcaggcgattctggat
ctgcgtttgcagaaactgaccggtcttgagcacgaaaaactgctcgacgaatacaaagag
ctgctggatcagatcgcggaactgttgcgtattcttggtagcgccgatcgtctgatggaa
gtgatccgtgaagagctggagctggttcgtgaacagttcggtgacaaacgtcgtactgaa
atcaccgccaacagcgcagacatcaacctggaagatctgatcacccaggaagatgtggtc
gtgacgctctctcaccagggctacgttaagtatcagccgctttctgaatacgaagcgcag
cgtcgtggcgggaaaggtaaatctgccgcacgtattaaagaagaagactttatcgaccga
ctgctggtggcgaacactcacgaccatattctgtgcttctccagccgtggtcgcgtctat
tcgatgaaagtttatcagttgccggaagccactcgtggcgcgcgcggtcgtccgatcgtc
aacctgctgccgctggagcaggacgaacgtatcactgcgatcctgccagtgaccgagttt
gaagaaggcgtgaaagtcttcatggcgaccgctaacggtaccgtgaagaaaactgtcctc
accgagttcaaccgtctgcgtaccgccggtaaagtggcgatcaaactggttgacggcgat
gagctgatcggcgttgacctgaccagcggcgaagacgaagtaatgctgttctccgctgaa
ggtaaagtggtgcgctttaaagagtcttctgtccgtgcgatgggctgcaacaccaccggt
gttcgcggtattcgcttaggtgaaggcgataaagtcgtctctctgatcgtgcctcgtggc
gatggcgcaatcctcaccgcaacgcaaaacggttacggtaaacgtaccgcagtggcggaa
tacccaaccaagtcgcgtgcgacgaaaggggttatctccatcaaggttaccgaacgtaac
ggtttagttgttggcgcggtacaggtagatgactgcgaccagatcatgatgatcaccgat
gccggtacgctggtacgtactcgcgtttcggaaatcagcatcgtgggccgtaacacccag
ggcgtgatcctcatccgtactgcggaagatgaaaacgtagtgggtctgcaacgtgttgct
gaaccggttgacgaggaagatctggataccatcgacggcagtgccgcggaaggggacgat
gaaatcgctccggaagtggacgttgacgacgagccagaagaagaataa

DBGET integrated database retrieval system