KEGG   Escherichia coli K-12 MG1655: b2240Help
Entry
b2240             CDS       T00007                                 

Gene name
glpT
Definition
(RefSeq) sn-glycerol-3-phosphate transporter
  KO
K02445  
MFS transporter, OPA family, glycerol-3-phosphate transporter
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Major Facilitator Superfamily (MFS)
  Phosphate and organophosphate transporters
   Organophosphate:Pi antiporter (OPA) family [TC:2.A.1.4]
    b2240 (glpT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2351016..2352374)
Genome map
AA seq 452 aa AA seqDB search
MLSIFKPAPHKARLPAAEIDPTYRRLRWQIFLGIFFGYAAYYLVRKNFALAMPYLVEQGF
SRGDLGFALSGISIAYGFSKFIMGSVSDRSNPRVFLPAGLILAAAVMLFMGFVPWATSSI
AVMFVLLFLCGWFQGMGWPPCGRTMVHWWSQKERGGIVSVWNCAHNVGGGIPPLLFLLGM
AWFNDWHAALYMPAFCAILVALFAFAMMRDTPQSCGLPPIEEYKNDYPDDYNEKAEQELT
AKQIFMQYVLPNKLLWYIAIANVFVYLLRYGILDWSPTYLKEVKHFALDKSSWAYFLYEY
AGIPGTLLCGWMSDKVFRGNRGATGVFFMTLVTIATIVYWMNPAGNPTVDMICMIVIGFL
IYGPVMLIGLHALELAPKKAAGTAAGFTGLFGYLGGSVAASAIVGYTVDFFGWDGGFMVM
IGGSILAVILLIVVMIGEKRRHEQLLQERNGG
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgttgagtatttttaaaccagcgccacacaaagcgcgcttacctgccgcggagatcgat
ccgacttatcgtcgattgcgctggcaaattttcctggggatattctttggctatgcggct
tactatttggttcgtaagaactttgcgcttgctatgccttatctggttgagcagggattc
tcacgcggtgatttaggttttgccctttcggggatctcgattgcttatggattttcgaaa
ttcatcatgggttcggtatcggatcgctcgaatccgcgcgttttcctgcccgcaggtttg
attctggcggcggcagtgatgttgtttatgggctttgtgccatgggcgacgtcgagcatt
gcggtgatgtttgtactgttgttcctctgcggttggttccaggggatggggtggccgccg
tgtggtcgtactatggtgcactggtggtcgcagaaagaacgtggcggcattgtgtcagtg
tggaactgtgcgcacaacgtcggtggtggtattccgccgctgctgttcctgctggggatg
gcctggttcaatgactggcatgcggcgctctatatgcctgctttctgcgccattctggtg
gcattattcgcctttgcgatgatgcgcgataccccgcaatcctgtggcttgccgccgatc
gaagagtacaaaaatgattatccggacgactataacgaaaaagcggaacaggagctgacg
gcgaagcaaatcttcatgcagtacgtactgccgaacaaactgctgtggtatatcgccatc
gccaacgtgttcgtttatctgctgcgttacggcatcctcgactggtcaccgacttatctg
aaagaggttaagcatttcgcgctagataaatcctcctgggcctacttcctttatgaatat
gcaggtattccgggcactctgctgtgcggctggatgtcggataaagtcttccgtggcaac
cgtggggcaaccggcgttttctttatgacactggtgaccatcgcgactatcgtttactgg
atgaacccggcaggtaacccaaccgtcgatatgatttgtatgattgttatcggcttcctg
atctacggtcctgtgatgctgatcggtctgcatgcgctggaactggcaccgaaaaaagcg
gcaggtacggcagcgggctttaccgggctgtttggttacctgggcggttcggtggcggcg
agcgcgattgttggctacaccgtggacttcttcggctgggatggcggctttatggtaatg
attggcggcagcattctggcggttatcttgttgattgttgtgatgattggcgaaaaacgt
cgccatgaacaattactgcaagaacgcaacggaggctaa

DBGET integrated database retrieval system