KEGG   Escherichia coli K-12 MG1655: b2245Help
Entry
b2245             CDS       T00007                                 

Gene name
rhmA
Definition
(RefSeq) 2-keto-3-deoxy-L-rhamnonate aldolase
  KO
K12660  
2-dehydro-3-deoxy-L-rhamnonate aldolase [EC:4.1.2.53]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    b2245 (rhmA)
Enzymes [BR:eco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.53  2-keto-3-deoxy-L-rhamnonate aldolase
     b2245 (rhmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
EcoGene: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2358042..2358845)
Genome map
AA seq 267 aa AA seqDB search
MNALLSNPFKERLRKGEVQIGLWLSSTTAYMAEIAATSGYDWLLIDGEHAPNTIQDLYHQ
LQAVAPYASQPVIRPVEGSKPLIKQVLDIGAQTLLIPMVDTAEQARQVVSATRYPPYGER
GVGASVARAARWGRIENYMAQVNDSLCLLVQVESKTALDNLDEILDVEGIDGVFIGPADL
SASLGYPDNAGHPEVQRIIETSIRRIRAAGKAAGFLAVAPDMAQQCLAWGANFVAVGVDT
MLYSDALDQRLAMFKSGKNGPRIKGSY
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcattattaagcaatccctttaaagaacgtttacgcaagggcgaagtgcaaatt
ggtctgtggttaagctcaacgactgcctatatggcagaaattgccgccacttctggttat
gactggttgctgattgacggggagcacgcgccaaacaccattcaggatctttatcatcag
ctacaggcggtagcgccctatgccagccaacccgtgatccgtccggtggaaggcagtaaa
ccgctgattaaacaagtcctggatattggcgcgcaaactctactgatcccgatggtcgat
actgccgaacaggcacgtcaggtggtgtctgccacgcgctatcctccctacggtgagcgt
ggtgtcggggccagtgtggcacgggctgcgcgctggggacgcattgagaattacatggcg
caagttaacgattcgctttgtctgttggtgcaggtggaaagtaaaacggcactggataac
ctggacgaaatcctcgacgtcgaagggattgatggcgtgtttattggacctgcggatctt
tctgcgtcgttgggctacccggataacgccgggcacccggaagtgcagcgaattattgaa
accagtattcggcggatccgtgctgcgggtaaagcggctggttttctggctgtggctcct
gatatggcgcagcaatgcctggcgtggggagcgaactttgtcgctgttggcgttgacacg
atgctctacagcgatgccctggatcaacgactggcgatgtttaaatcaggcaaaaatggg
ccacgcataaaaggtagttattga

DBGET integrated database retrieval system