KEGG   Escherichia coli K-12 MG1655: b2246Help
Entry
b2246             CDS       T00007                                 

Gene name
rhmT
Definition
(RefSeq) putative L-rhamnonate transporter
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ASAP: 
UniProt: 
Position
complement(2358863..2360152)
Genome map
AA seq 429 aa AA seqDB search
MSTALLDAVVKKNRVRLIPFMLALYVLAFLDRSNIGFAKQTYQIDTGLSNEAYALGAGIF
FVVYAFLGVPANLLMRKLGARTWIGTTTLLWGFLSAAMAWADTEAKFLIVRTLLRAAEAG
FFPGMIYLTSQWFPQRNRASIMGLFYMGAPLALTLGSPLSGALLEMHGFMGHPGWFWMFV
IEGLLAVGAGVFTFFWLDDTPEQARFLSKQEKTLLINQLASEEQQKVTSRLSDALRNGRV
WQLAIIYLTIQVAVYGLIFFLPTQVAALLGTKVGFTASVVTAIPWVAALFGTWLIPRYSD
KTGERRNVAALTLLAAGIGIGLSGLLSPVMAIVALCVAAIGFIAVQPVFWTMPTQLLSGT
ALAAGIGFVNLFGAVGGFIAPILRVKAETLFASDAAGLLTLAAVAVIGSLIIFTLRVNRT
VAQTDVAHH
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgctttgcttgacgccgtggtgaagaaaaaccgtgtgcgtttaattccgttt
atgttggcgctgtatgtgctggcgtttctcgaccgttcgaatatcggttttgccaaacag
acctaccagattgataccgggttgagtaatgaagcttatgcgctgggagcaggcattttc
tttgtggtatatgcgtttctgggtgttccggcgaatcttttgatgcgcaaactgggggcc
agaacctggattggtacgacaacactgctgtggggatttctttcggcagccatggcatgg
gccgatactgaagcgaaatttctgatagttcgcactctgcttcgtgctgcggaggccgga
tttttccctggtatgatttatctcacctcgcaatggtttccgcagcgtaatcgcgccagc
attatggggctgttctatatgggcgcaccgctggcgttaacactgggatcaccgctttcc
ggcgcgctgttggagatgcatggatttatggggcatcccggctggttctggatgtttgtg
attgaaggattgttggcagtcggtgctggggtattcacattcttttggcttgatgacaca
ccggagcaggcacgttttctgagtaaacaagaaaaaacgttgcttatcaatcaactggca
agtgaagaacaacagaaagtgacttctcggctgagcgatgcgctgcgtaatggccgagtc
tggcaactagcgattatctacctgaccattcaggtggcggtttacggattaattttcttc
ctgccgacccaggttgcggcattgctgggaacaaaagtgggctttacagcgtcggtggtc
accgccattccgtgggttgcggccttgtttgggacctggcttattccgcgctattccgat
aaaaccggcgaacggcgtaatgtcgcagcgctgacattactggcggcgggcattggtatt
ggtctgtccgggctgctttctccagtaatggcgatcgtagcgctgtgtgttgcagctatc
gggtttattgccgtgcagccagtgttctggacgatgccgacacaactgctttccggtacg
gcgctggctgcgggaattggttttgtaaacctgtttggtgcagtgggcgggtttattgcc
ccgatcctgcgcgtgaaagcagaaacgttatttgccagcgatgcggcgggattactgacg
ctggcagcggtggcggtcatcggttcgctgattattttcactctgcgtgtaaatcgcact
gttgcgcagaccgacgtggcacatcattaa

DBGET integrated database retrieval system