KEGG   Escherichia coli K-12 MG1655: b2248Help
Entry
b2248             CDS       T00007                                 

Gene name
rhmR
Definition
(RefSeq) putative DNA-binding transcriptional regulator for the rhm operon
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IclR HTH_IclR HTH_20 TrmB HTH_5 MarR_2
Motif
Other DBs
NCBI-GeneID: 944752
NCBI-ProteinID: NP_416751
Pasteur: yfaX
RegulonDB: ECK120003737
ASAP: ABE-0007438
UniProt: P77732
Position
complement(2361429..2362211)
Genome map
AA seq 260 aa AA seqDB search
MLESSKVPALTRAIDILNLIARIGPCSAATIIDTLGIPKSTAYLLLNELRRQRFLSLDHQ
ENFCLWTRLVELSGHALSKMDLRELARPRLTQLMDTTGLLCHLGIIDNGSAYYILKVESS
ATISVRSHEGKSLSLYRSGIGKCLLAWQPAAVQQSIIEGLVWEQATPTTITHPQQLHEEL
ARIRRQGWSYDNGEDYADVRCVAAPVFNANNELTAAISVVGTRLQINEEYRDYLAGKAIA
CARDISRLLGWKSPFDLQAS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgttggaatcaagcaaagttcccgccctgacacgggctattgatattctcaatttgatt
gcccgcattggcccctgtagtgctgcgacgatcattgacacattgggaatccctaaaagc
acggcctatttgctgcttaatgaactcaggcgtcagcgttttcttagccttgatcaccag
gaaaatttttgtttgtggaccaggctggtggagctttccggtcatgcgttaagcaagatg
gatctccgggaactggctcgaccgcgtttgacgcaactgatggataccaccgggctgtta
tgtcacctggggattattgataacggcagcgcttattacattttgaaagtggagtcatca
gccactatcagcgtgcgttcccatgaaggaaaaagcctttcgctttatcgctccggaata
ggtaaatgcctgcttgcctggcaacctgcagcggtacagcaaagtattatcgaagggctg
gtctgggagcaggcgacacccacaacgattactcatccacagcaacttcacgaagaactg
gcgcgtattcgccgtcagggctggagctatgacaacggcgaagattacgccgatgtccgt
tgtgtcgctgcgccggtgtttaacgccaataacgagcttaccgctgcgatctcggtggtc
ggtacccgcttacaaatcaatgaagaataccgtgattatctggcgggcaaggccattgcc
tgcgccagggatatttcacgtctgttgggatggaaaagtccctttgacttacaagcctca
taa

DBGET integrated database retrieval system