KEGG   Escherichia coli K-12 MG1655: b2254Help
Entry
b2254             CDS       T00007                                 

Gene name
arnC
Definition
(RefSeq) undecaprenyl phosphate-L-Ara4FN transferase
  KO
K10012  
undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase [EC:2.4.2.53]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Amino sugar and nucleotide sugar metabolism
Cationic antimicrobial peptide (CAMP) resistance
Module
Cationic antimicrobial peptide (CAMP) resistance, arnBCADTEF operon
Undecaprenylphosphate alpha-L-Ara4N biosynthesis, UDP-GlcA => undecaprenyl phosphate alpha-L-Ara4N
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    b2254 (arnC)
 Human Diseases
  Drug resistance
   01503 Cationic antimicrobial peptide (CAMP) resistance
    b2254 (arnC)
Enzymes [BR:eco01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.53  undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase
     b2254 (arnC)
Lipopolysaccharide biosynthesis proteins [BR:eco01005]
 Unusual sugar
  b2254 (arnC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
2367071..2368039
Genome map
AA seq 322 aa AA seqDB search
MFEIHPVKKVSVVIPVYNEQESLPELIRRTTTACESLGKEYEILLIDDGSSDNSAHMLVE
ASQAENSHIVSILLNRNYGQHSAIMAGFSHVTGDLIITLDADLQNPPEEIPRLVAKADEG
YDVVGTVRQNRQDSWFRKTASKMINRLIQRTTGKAMGDYGCMLRAYRRHIVDAMLHCHER
STFIPILANIFARRAIEIPVHHAEREFGESKYSFMRLINLMYDLVTCLTTTPLRMLSLLG
SIIAIGGFSIAVLLVILRLTFGPQWAAEGVFMLFAVLFTFIGAQFIGMGLLGEYIGRIYT
DVRARPRYFVQQVIRPSSKENE
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaaatccaccctgttaagaaagtctcggtggttattcccgtttataacgagcag
gaaagcttaccggaattaatcaggcgcaccaccacagcctgtgaatcgttggggaaagag
tatgagatcctgctgattgatgacggcagtagcgataattccgcgcatatgctggtcgaa
gcctcacaagcggagaacagccatattgtgtctattttgcttaaccgcaattacgggcaa
cattcagcgattatggcgggattcagtcacgttactggcgacttaattattacccttgat
gccgatctccagaatccgccagaagaaatcccccgcctggtggcaaaagccgatgaaggt
tacgacgtggtagggactgtacgccagaaccgccaggacagctggtttcgtaaaaccgct
tcgaagatgattaaccggcttattcagcgcaccactggcaaagcgatgggtgattacggt
tgtatgctgcgcgcctatcgccgtcatattgtcgatgcgatgttgcactgccatgaacgc
agcacctttatcccgattctggcgaatatcttcgcccgccgtgccattgaaattccagta
catcatgccgagcgtgagtttggtgaatccaaatacagttttatgcgcctgattaatttg
atgtacgacctggtgacctgccttaccacaacgccgctacgtatgctgagtctgctcggc
agcattattgcgattggaggttttagcattgcggtgctgctggtgattttacgcctgacc
ttcggaccacaatgggcggcagaaggcgtctttatgctatttgccgtgctgtttactttt
attggcgctcagtttatcggcatgggattactcggtgaatatatcggcaggatctacacc
gatgtccgcgcccgcccccgctattttgttcagcaagttatccgtccatccagcaaggaa
aatgaataa

DBGET integrated database retrieval system