KEGG   Escherichia coli K-12 MG1655: b2258Help
Entry
b2258             CDS       T00007                                 

Gene name
arnF
Definition
(RefSeq) undecaprenyl phosphate-alpha-L-ara4N exporter; flippase ArnEF subunit
  KO
K12963  
undecaprenyl phosphate-alpha-L-ara4N flippase subunit ArnF
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Cationic antimicrobial peptide (CAMP) resistance
Module
Cationic antimicrobial peptide (CAMP) resistance, arnBCADTEF operon
Brite
KEGG Orthology (KO) [BR:eco00001]
 Human Diseases
  Antimicrobial resistance
   01503 Cationic antimicrobial peptide (CAMP) resistance
    b2258 (arnF)
Lipopolysaccharide biosynthesis proteins [BR:eco01005]
 Unusual sugar
  b2258 (arnF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
2372892..2373278
Genome map
AA seq 128 aa AA seqDB search
MGLMWGLFSVIIASVAQLSLGFAASHLPPMTHLWDFIAALLAFGLDARILLLGLLGYLLS
VFCWYKTLHKLALSKAYALLSMSYVLVWIASMVLPGWEGTFSLKALLGVACIMSGLMLIF
LPTTKQRY
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgggcctgatgtggggattattcagcgtcattattgcctcagttgcgcaattaagcctg
ggttttgcggcgagtcatctgccgccgatgacgcacttatgggattttatcgcggctctg
ttagcttttggcctggatgcccggatactgttactcgggctgctgggttatctgctttcc
gttttttgttggtataaaacgcttcataaacttgcgctaagcaaagcctatgccttgctc
agtatgagttatgtgctggtatggattgcttcaatggtacttcccggctgggaagggact
ttttcgctgaaagcactactgggagtagcctgtattatgagcgggttgatgctgattttc
ctgcccacgacaaaacaacgttactga

DBGET integrated database retrieval system