KEGG   Escherichia coli K-12 MG1655: b2258Help
Entry
b2258             CDS       T00007                                 

Gene name
arnF
Definition
(RefSeq) undecaprenyl phosphate-alpha-L-ara4N exporter; flippase ArnEF subunit
  KO
K12963  undecaprenyl phosphate-alpha-L-ara4N flippase subunit ArnF
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco01503  Cationic antimicrobial peptide (CAMP) resistance
Module
eco_M00721  Cationic antimicrobial peptide (CAMP) resistance, arnBCADTEF operon
Brite
KEGG Orthology (KO) [BR:eco00001]
 Human Diseases
  Drug resistance
   01503 Cationic antimicrobial peptide (CAMP) resistance
    b2258 (arnF)
Lipopolysaccharide biosynthesis proteins [BR:eco01005]
 Unusual sugar
  b2258 (arnF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Multi_Drug_Res EamA 7TM-7TMR_HD
Motif
Other DBs
NCBI-GeneID: 945344
NCBI-ProteinID: NP_416761
Pasteur: yfbJ
RegulonDB: ECK120003747
ECOCYC: G7171
ASAP: ABE-0007466
UniProt: P76474
Position
2372892..2373278
Genome map
AA seq 128 aa AA seqDB search
MGLMWGLFSVIIASVAQLSLGFAASHLPPMTHLWDFIAALLAFGLDARILLLGLLGYLLS
VFCWYKTLHKLALSKAYALLSMSYVLVWIASMVLPGWEGTFSLKALLGVACIMSGLMLIF
LPTTKQRY
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgggcctgatgtggggattattcagcgtcattattgcctcagttgcgcaattaagcctg
ggttttgcggcgagtcatctgccgccgatgacgcacttatgggattttatcgcggctctg
ttagcttttggcctggatgcccggatactgttactcgggctgctgggttatctgctttcc
gttttttgttggtataaaacgcttcataaacttgcgctaagcaaagcctatgccttgctc
agtatgagttatgtgctggtatggattgcttcaatggtacttcccggctgggaagggact
ttttcgctgaaagcactactgggagtagcctgtattatgagcgggttgatgctgattttc
ctgcccacgacaaaacaacgttactga

DBGET integrated database retrieval system