KEGG   Escherichia coli K-12 MG1655: b2260Help
Entry
b2260             CDS       T00007                                 

Gene name
menE
Definition
(RefSeq) O-succinylbenzoate-CoA ligase (EC:6.2.1.26)
  KO
K01911  
O-succinylbenzoic acid--CoA ligase [EC:6.2.1.26]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Ubiquinone and other terpenoid-quinone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Menaquinone biosynthesis, chorismate => menaquinone
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    b2260 (menE)
Enzymes [BR:eco01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.26  o-succinylbenzoate---CoA ligase
     b2260 (menE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2373648..2375003)
Genome map
AA seq 451 aa AA seqDB search
MIFSDWPWRHWRQVRGETIALRLNDEQLNWRELCARVDELASGFAVQGVVEGSGVMLRAW
NTPQTLLAWLALLQCGARVLPVNPQLPQPLLEELLPNLTLQFALVPDGENTFPALTSLHI
QLVEGAHAATWQPTRLCSMTLTSGSTGLPKAAVHTYQAHLASAQGVLSLIPFGDHDDWLL
SLPLFHVSGQGIMWRWLYAGARMTVRDKQPLEQMLAGCTHASLVPTQLWRLLVNRSSVSL
KAVLLGGAAIPVELTEQAREQGIRCFCGYGLTEFASTVCAKEADGLADVGSPLPGREVKI
VNNEVWLRAASMAEGYWRNGQLVSLVNDEGWYATRDRGEMHNGKLTIVGRLDNLFFSGGE
GIQPEEVERVIAAHPAVLQVFIVPVADKEFGHRPVAVMEYDHESVDLSEWVKDKLARFQQ
PVRWLTLPPELKNGGIKISRQALKEWVQRQQ
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgatcttctctgactggccgtggcgtcactggcggcaagtgcggggagaaaccatcgcc
ttacgtcttaatgacgagcaactcaactggcgcgagctttgtgctcgcgtcgatgaatta
gcctccggatttgcggtgcagggggtggttgagggcagcggcgtgatgttgcgggcgtgg
aatacgccgcaaacgctgctcgcctggctggcgttactgcaatgcggggcgcgggtgttg
cccgtgaaccctcagctgccgcaaccgttgcttgaagaattgctgcccaatctgacgctg
caatttgctctggtgccggatggggaaaacacgtttccggcattaacgtcgctgcacatt
cagctggttgaaggcgcacatgccgctacgtggcagccgacgcgtctgtgctcaatgacg
ttgacctcgggttctaccggtttgccgaaagccgctgtccatacttatcaggcccatctt
gccagtgcgcaaggtgtgttatcgctgattccgtttggcgatcacgatgattggttgctc
tctttaccgctgtttcacgtctccggtcagggaattatgtggcgctggttatacgctggt
gcgcggatgacggtacgtgataaacagccattggagcaaatgctggcaggctgtactcac
gcttcactggtgccaacacaactctggcgtttgctggttaaccgtagttccgtttccctg
aaagcggtgttacttggcggcgcggctatcccggtcgagttgacggaacaggcgcgcgag
caggggattcgttgcttttgcggctatggtctgaccgagtttgcctccacggtgtgtgcg
aaagaagccgacggcctggcagacgttggttcgccgctgccgggtcgggaagtgaaaatc
gttaataatgaagtgtggctgcgggctgccagtatggcagaaggttactggcgtaacggg
caactggtttcactggttaatgacgaaggctggtacgctacgcgcgatcgcggtgagatg
cataatggcaagctgaccattgtcggacgtttagacaatctattcttcagtggcggagag
ggtattcagccggaagaagtcgagcgcgtaattgctgcacatcctgcggttttgcaggtg
tttatcgtccccgttgccgacaaggagtttggtcatcgaccggtggcggtgatggagtat
gaccacgagagcgttgatcttagtgaatgggtgaaagataagctggcccgttttcaacaa
ccggtgcgctggctaactctgccgccggagctgaaaaacggcggtattaaaatttcacgt
caggcgctaaaagagtgggtgcaacgtcagcaataa

DBGET integrated database retrieval system