KEGG   Escherichia coli K-12 MG1655: b2261Help
Entry
b2261             CDS       T00007                                 

Gene name
menC
Definition
(RefSeq) O-succinylbenzoyl-CoA synthase (EC:4.2.1.-)
  KO
K02549  
O-succinylbenzoate synthase [EC:4.2.1.113]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Ubiquinone and other terpenoid-quinone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Menaquinone biosynthesis, chorismate => menaquinone
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    b2261 (menC)
Enzymes [BR:eco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.113  o-succinylbenzoate synthase
     b2261 (menC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2375000..2375962)
Genome map
AA seq 320 aa AA seqDB search
MRSAQVYRWQIPMDAGVVLRDRRLKTRDGLYVCLREGEREGWGEISPLPGFSQETWEEAQ
SVLLAWVNNWLAGDCELPQMPSVAFGVSCALAELTDTLPQAANYRAAPLCNGDPDDLILK
LADMPGEKVAKVKVGLYEAVRDGMVVNLLLEAIPDLHLRLDANRAWTPLKGQQFAKYVNP
DYRDRIAFLEEPCKTRDDSRAFARETGIAIAWDESLREPDFAFVAEEGVRAVVIKPTLTG
SLEKVREQVQAAHALGLTAVISSSIESSLGLTQLARIAAWLTPDTIPGLDTLDLMQAQQV
RRWPGSTLPVVEVDALERLL
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgcgtagcgcgcaggtataccgctggcagatccccatggacgcgggggtggttctgcgc
gacaggcggttaaaaacccgcgacgggctgtatgtttgcctgcgtgaaggcgagcgcgaa
gggtggggggagatctccccactgccgggcttcagtcaggaaacctgggaagaggcgcaa
agtgtgctgcttgcctgggtaaataactggctggcaggcgattgcgagctaccgcagatg
ccttccgtggcctttggcgtaagctgtgcattggcagaactgacagatacgttgccgcaa
gcagccaactaccgtgcggcaccgctgtgtaatggcgatccggacgatctgatcctcaaa
cttgcagatatgccaggcgagaaagtggcgaaggtcaaagtgggattgtacgaagcggtg
cgcgacggcatggtggtgaatctgttgctggaggcaattccggatctgcatttgcgtctt
gacgcaaatcgcgcctggacaccgctgaaaggtcagcagtttgccaaatacgttaacccg
gattatcgcgaccgcatcgcgtttctcgaagagccgtgcaaaacccgcgatgattcgcga
gcgtttgcccgtgaaaccggcattgccattgcctgggatgaaagcctgcgcgagccggat
tttgcctttgtggctgaagagggcgtgcgcgcggtagttatcaaacccacgctcacgggc
agtctggaaaaagtacgcgagcaggtacaggcggcgcacgcgctggggctgacggcggtg
atcagttcttccattgaatcgagcttaggcttaacgcaactggcgcggattgccgcctgg
ttaacgccggacaccattccagggctggacacgctggatctgatgcaggcgcagcaggta
cgtcgctggccgggtagcacgctgcctgtcgtggaagttgatgcactggagcggttgtta
tga

DBGET integrated database retrieval system