KEGG   Escherichia coli K-12 MG1655: b2263Help
Entry
b2263             CDS       T00007                                 

Gene name
menH
Definition
(RefSeq) 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
  KO
K08680  
2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase [EC:4.2.99.20]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Ubiquinone and other terpenoid-quinone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Menaquinone biosynthesis, chorismate => menaquinone
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    b2263 (menH)
Enzymes [BR:eco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.20  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
     b2263 (menH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2376834..2377592)
Genome map
AA seq 252 aa AA seqDB search
MILHAQAKHGKPGLPWLVFLHGFSGDCHEWQEVGEAFADYSRLYVDLPGHGGSAAISVDG
FDDVTDLLRKTLVSYNILDFWLVGYSLGGRVAMMAACQGLAGLCGVIVEGGHPGLQNAEQ
RAERQRSDRQWVQRFLTEPLTAVFADWYQQPVFASLNDDQRRELVALRSNNNGATLAAML
EATSLAVQPDLRANLSARTFAFYYLCGERDSKFRALAAELAADCHVIPRAGHNAHRENPA
GVIASLAQILRF
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgatcctgcacgcgcaggcaaaacacggaaaaccaggtttaccctggctggtgtttttg
cacggtttttccggcgattgccacgaatggcaagaagtgggcgaggcgtttgccgactac
tcacggttgtatgttgatctcccaggtcacggtggttcggcggcgattagcgtcgatgga
tttgatgatgtcaccgacttactgcgtaaaaccttggttagttacaacatccttgacttc
tggctggtggggtactcgcttggtggacgggtggcgatgatggcggcttgccaggggctg
gcggggctttgtggggttattgtcgaaggcgggcatccggggctgcaaaatgctgaacaa
cgtgcggaacgtcagcgttccgatcgccaatgggtgcagcgttttctcacagaaccgtta
acggcggtatttgccgactggtatcaacagcctgtttttgcctcactcaatgacgatcaa
cgccgggagctggtggcgctgcgcagcaacaataatggcgcaacgcttgccgccatgctg
gaggcgacttctctcgccgtccagcctgatttacgtgctaaccttagcgcccgcacattt
gcgttttattatttatgtggtgaacgtgacagcaaattccgcgccctggcggcggaactg
gctgccgactgccatgtcattcctcgcgccggacataacgcgcatcgggaaaatcccgct
ggcgtaatcgcaagtctggcgcagatcttgcgtttctga

DBGET integrated database retrieval system