KEGG   Escherichia coli K-12 MG1655: b2263Help
Entry
b2263             CDS       T00007                                 

Gene name
menH
Definition
(RefSeq) 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
  KO
K08680  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase [EC:4.2.99.20]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00130  Ubiquinone and other terpenoid-quinone biosynthesis
eco01100  Metabolic pathways
eco01110  Biosynthesis of secondary metabolites
Module
eco_M00116  Menaquinone biosynthesis, chorismate => menaquinone
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    b2263 (menH)
Enzymes [BR:eco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.20  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
     b2263 (menH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_6 Abhydrolase_1 Hydrolase_4 Thioesterase Lipase_3
Motif
Other DBs
NCBI-GeneID: 946736
NCBI-ProteinID: NP_416766
Pasteur: yfbB
RegulonDB: ECK120002292
ECOCYC: EG12438
ASAP: ABE-0007478
UniProt: P37355
Structure
PDB: 

Jmol
Position
complement(2376834..2377592)
Genome map
AA seq 252 aa AA seqDB search
MILHAQAKHGKPGLPWLVFLHGFSGDCHEWQEVGEAFADYSRLYVDLPGHGGSAAISVDG
FDDVTDLLRKTLVSYNILDFWLVGYSLGGRVAMMAACQGLAGLCGVIVEGGHPGLQNAEQ
RAERQRSDRQWVQRFLTEPLTAVFADWYQQPVFASLNDDQRRELVALRSNNNGATLAAML
EATSLAVQPDLRANLSARTFAFYYLCGERDSKFRALAAELAADCHVIPRAGHNAHRENPA
GVIASLAQILRF
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgatcctgcacgcgcaggcaaaacacggaaaaccaggtttaccctggctggtgtttttg
cacggtttttccggcgattgccacgaatggcaagaagtgggcgaggcgtttgccgactac
tcacggttgtatgttgatctcccaggtcacggtggttcggcggcgattagcgtcgatgga
tttgatgatgtcaccgacttactgcgtaaaaccttggttagttacaacatccttgacttc
tggctggtggggtactcgcttggtggacgggtggcgatgatggcggcttgccaggggctg
gcggggctttgtggggttattgtcgaaggcgggcatccggggctgcaaaatgctgaacaa
cgtgcggaacgtcagcgttccgatcgccaatgggtgcagcgttttctcacagaaccgtta
acggcggtatttgccgactggtatcaacagcctgtttttgcctcactcaatgacgatcaa
cgccgggagctggtggcgctgcgcagcaacaataatggcgcaacgcttgccgccatgctg
gaggcgacttctctcgccgtccagcctgatttacgtgctaaccttagcgcccgcacattt
gcgttttattatttatgtggtgaacgtgacagcaaattccgcgccctggcggcggaactg
gctgccgactgccatgtcattcctcgcgccggacataacgcgcatcgggaaaatcccgct
ggcgtaatcgcaagtctggcgcagatcttgcgtttctga

DBGET integrated database retrieval system