KEGG   Escherichia coli K-12 MG1655: b2265Help
Entry
b2265             CDS       T00007                                 

Gene name
menF
Definition
(RefSeq) isochorismate synthase 2 (EC:5.4.4.2)
  KO
K02552  
menaquinone-specific isochorismate synthase [EC:5.4.4.2]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Ubiquinone and other terpenoid-quinone biosynthesis
Biosynthesis of siderophore group nonribosomal peptides
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
Menaquinone biosynthesis, chorismate => menaquinone
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    b2265 (menF)
  Metabolism of terpenoids and polyketides
   01053 Biosynthesis of siderophore group nonribosomal peptides
    b2265 (menF)
Enzymes [BR:eco01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.2  isochorismate synthase
     b2265 (menF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2379348..2380643)
Genome map
AA seq 431 aa AA seqDB search
MQSLTTALENLLRHLSQEIPATPGIRVIDIPFPLKDAFDALSWLASQQTYPQFYWQQRNG
DEEAVVLGAITRFTSLDQAQRFLRQHPEHADLRIWGLNAFDPSQGNLLLPRLEWRRCGGK
ATLRLTLFSESSLQHDAIQAKEFIATLVSIKPLPGLHLTTTREQHWPDKTGWTQLIELAT
KTIAEGELDKVVLARATDLHFASPVNAAAMMAASRRLNLNCYHFYMAFDGENAFLGSSPE
RLWRRRDKALRTEALAGTVANNPDDKQAQQLGEWLMADDKNQRENMLVVEDICQRLQADT
QTLDVLPPQVLRLRKVQHLRRCIWTSLNKADDVICLHQLQPTAAVAGLPRDLARQFIARH
EPFTREWYAGSAGYLSLQQSEFCVSLRSAKISGNVVRLYAGAGIVRGSDPEQEWQEIDNK
AAGLRTLLQME
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
gtgcaatcacttactacggcgctggaaaatctactgcgccatttgtcgcaagagattccg
gcgacacccggcattcgggttatcgatattcctttccctctcaaagacgcttttgatgcc
ttgagctggctggccagtcagcaaacatacccgcaattctactggcaacaacgtaatggt
gatgaagaagctgtcgtcctgggcgcgattacccgttttacgtcgttggaccaggcacaa
cgttttcttcgccagcacccggaacacgccgacttacgcatttgggggctgaatgctttt
gacccgtcgcagggcaatttacttttaccccgcctggaatggcgacgctgtggcggtaaa
gccacgctgcggctgacgctattcagcgaaagctcccttcagcacgatgcgattcaggca
aaagaatttatcgccacactggtgagtatcaagcccttgcctgggttacatttaaccacc
acgcgagaacaacactggccggacaaaacgggctggacgcaattaatcgaactggcaacg
aaaaccatcgccgaaggtgagctcgacaaagtggtgctcgctcgggcaactgacctgcat
ttcgcaagtccggtcaacgcggcggcgatgatggctgccagtcgtcgactgaatctgaat
tgctaccatttttacatggcctttgatggcgaaaatgcttttcttggctcttcaccggaa
cggttatggcggcggcgtgacaaagcgctgcgtactgaagcgctggcgggaacagtagca
aataatcctgatgataagcaggcgcagcagttaggagagtggctgatggcggatgataaa
aaccagcgcgagaacatgctggtggtggaagatatctgtcaacgattacaggccgatacc
cagacgctggatgttttaccgccgcaggtactgcgtctgcgtaaagtgcagcatcttcgc
cgctgtatctggacttcactcaacaaagcggatgatgtgatctgtttacatcagttgcag
ccaacggcagcagttgctggcttaccgcgcgatctggcgcgacagtttatcgcccgtcac
gaaccgttcacccgagaatggtacgccggttctgcgggctatctctcattacaacaaagc
gaattctgcgtttccctgcgctcagcaaaaattagcggcaatgtcgtgcgattatatgct
ggcgcgggcattgtccgtggttccgaccccgagcaagagtggcaggaaatcgacaacaaa
gcggcagggctgcgtactttattacaaatggaatag

DBGET integrated database retrieval system