KEGG   Escherichia coli K-12 MG1655: b2287Help
Entry
b2287             CDS       T00007                                 

Gene name
nuoB
Definition
(RefSeq) NADH:ubiquinone oxidoreductase, chain B (EC:1.6.5.3)
  KO
K00331  
NADH-quinone oxidoreductase subunit B [EC:1.6.5.3]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    b2287 (nuoB)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     b2287 (nuoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(2403951..2404613)
Genome map
AA seq 220 aa AA seqDB search
MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLNDMVNWGRKNSIWPYNFG
LSCCYVEMVTSFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEP
KWVISMGACANSGGMYDIYSVVQGVDKFIPVDVYIPGCPPRPEAYMQALMLLQESIGKER
RPLSWVVGDQGVYRANMQSERERKRGERIAVTNLRTPDEI
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggattatacgctcacccgcatagatcccaacggtgagaacgaccgttaccccctgcaa
aagcaggagatcgtaaccgaccctctggagcaagaagttaacaaaaacgtgtttatgggc
aagctcaatgacatggttaactggggtcgtaaaaactcaatttggccgtataacttcggt
ctttcctgctgttacgttgagatggtgacttcgtttaccgcggtgcatgacgtggcgcgt
tttggcgcagaagtattgcgtgcttcgccgcgtcaggctgacctgatggtggttgcagga
acctgctttaccaaaatggcaccggttattcagcgtctgtatgaccagatgctggaacca
aaatgggttatctcaatgggtgcctgtgccaactctggtggtatgtacgatatttattcc
gttgtgcagggcgtcgataaattcatcccggttgatgtgtatatcccgggctgcccgccg
cgtcctgaagcgtacatgcaggcactgatgctgttgcaggaatctatcggcaaagaacgt
cgtccgctctcctgggtggttggcgatcagggcgtttatcgcgccaatatgcaatcagag
cgcgaacgcaagcgcggtgaacgcattgccgtaactaacctgcgtacacctgacgagatt
taa

DBGET integrated database retrieval system