KEGG   Escherichia coli K-12 MG1655: b2289Help
Entry
b2289             CDS       T00007                                 

Gene name
lrhA
Definition
(RefSeq) transcriptional repressor of flagellar, motility and chemotaxis genes
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(2405703..2406641)
Genome map
AA seq 312 aa AA seqDB search
MISANRPIINLDLDLLRTFVAVADLNTFAAAAAAVCRTQSAVSQQMQRLEQLVGKELFAR
HGRNKLLTEHGIQLLGYARKILRFNDEACSSLMFSNLQGVLTIGASDESADTILPFLLNR
VSSVYPKLALDVRVKRNAYMAEMLESQEVDLMVTTHRPSAFKALNLRTSPTHWYCAAEYI
LQKGEPIPLVLLDDPSPFRDMVLATLNKADIPWRLAYVASTLPAVRAAVKAGLGVTARPV
EMMSPDLRVLSGVDGLPPLPDTEYLLCYDPSSNNELAQVIYQAMESYHNPWQYSPMSAPE
GDDSLLIERDIE
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgataagtgcaaatcgtccgataattaacctcgacctcgatctgctgagaacatttgtt
gctgttgccgatctgaacacttttgctgccgcagctgccgctgtgtgtcgtactcagtcc
gccgtaagtcagcaaatgcagcgtctggaacaactcgttgggaaagaactgttcgctcgt
cacggtcgcaacaaactgttaactgaacatggcattcaacttcttggttacgccaggaaa
atcctgcgttttaatgatgaggcctgctcatcattaatgttcagtaatcttcagggcgta
ttaactatcggtgcttcagatgaatctgccgatacgatcttacctttcctgttaaatcgc
gtgagttcggtttatccgaaattagcgctggatgtccgcgttaaacgtaatgcctatatg
gcagaaatgctggaatcccaggaagtggatttgatggtaaccacccatcgtccttcagcg
tttaaggcattgaacctgcgtacctcgccaacacactggtactgcgcagcggaatacata
ttgcaaaaaggcgagccgatccctcttgtattgctggatgatcctagcccgtttcgcgat
atggtgctggcgacgcttaataaagcagatattccatggcgactggcttatgtcgcctcg
acgcttccggccgttcgtgcggcagtgaaagccggtcttggcgtgacggcaaggccggtt
gagatgatgagcccggacctgcgtgtgctgagtggagtagatggcttaccgccgctacct
gataccgaatatttgctgtgctatgatccgtccagtaataatgagctggcccaggtgatc
tatcaggcgatggagagctaccataatccgtggcaatacagcccaatgtctgctccggaa
ggggatgattcattgttgattgaaagggatatcgagtaa

DBGET integrated database retrieval system