KEGG   Escherichia coli K-12 MG1655: b2316Help
Entry
b2316             CDS       T00007                                 

Gene name
accD
Definition
(RefSeq) acetyl-CoA carboxylase, beta (carboxyltransferase) subunit (EC:6.4.1.2)
  KO
K01963  
acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    b2316 (accD)
   01212 Fatty acid metabolism
    b2316 (accD)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    b2316 (accD)
   00640 Propanoate metabolism
    b2316 (accD)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    b2316 (accD)
  Metabolism of terpenoids and polyketides
   00253 Tetracycline biosynthesis
    b2316 (accD)
Enzymes [BR:eco01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     b2316 (accD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2433012..2433926)
Genome map
AA seq 304 aa AA seqDB search
MSWIERIKSNITPTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMTARNR
LHSLLDEGSLVELGSELEPKDVLKFRDSKKYKDRLASAQKETGEKDALVVMKGTLYGMPV
VAAAFEFAFMGGSMGSVVGARFVRAVEQALEDNCPLICFSASGGARMQEALMSLMQMAKT
SAALAKMQERGLPYISVLTDPTMGGVSASFAMLGDLNIAEPKALIGFAGPRVIEQTVREK
LPPGFQRSEFLIEKGAIDMIVRRPEMRLKLASILAKLMNLPAPNPEAPREGVVVPPVPDQ
EPEA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagctggattgaacgaattaaaagcaacattactcccacccgcaaggcgagcattcct
gaaggggtgtggactaagtgtgatagctgcggtcaggttttataccgcgctgagctggaa
cgtaatcttgaggtctgtccgaagtgtgaccatcacatgcgtatgacagcgcgtaatcgc
ctgcatagcctgttagatgaaggaagccttgtggagctgggtagcgagcttgagccgaaa
gatgtgctgaagtttcgtgactccaagaagtataaagaccgtctggcatctgcgcagaaa
gaaaccggcgaaaaagatgcgctggtggtgatgaaaggcactctgtatggaatgccggtt
gtcgctgcggcattcgagttcgcctttatgggcggttcaatggggtctgttgtgggtgca
cgtttcgtgcgtgccgttgagcaggcgctggaagataactgcccgctgatctgcttctcc
gcctctggtggcgcacgtatgcaggaagcactgatgtcgctgatgcagatggcgaaaacc
tctgcggcactggcaaaaatgcaggagcgcggcttgccgtacatctccgtgctgaccgac
ccgacgatgggcggtgtttctgcaagtttcgccatgctgggcgatctcaacatcgctgaa
ccgaaagcgttaatcggctttgccggtccgcgtgttatcgaacagaccgttcgcgaaaaa
ctgccgcctggattccagcgcagtgaattcctgatcgagaaaggcgcgatcgacatgatc
gtccgtcgtccggaaatgcgcctgaaactggcgagcattctggcgaagttgatgaatctg
ccagcgccgaatcctgaagcgccgcgtgaaggcgtagtggtacccccggtaccggatcag
gaacctgaggcctga

DBGET integrated database retrieval system