KEGG   Escherichia coli K-12 MG1655: b2330Help
Entry
b2330             CDS       T00007                                 

Gene name
prmB
Definition
N5-glutamine methyltransferase (EC:2.1.1.-)
Orthology
K07320  
putative adenine-specific DNA-methyltransferase [EC:2.1.1.72]
Organism
eco  Escherichia coli K-12 MG1655
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(2447508..2448440)
Genome map
AA seq 310 aa AA seqDB search
MDKIFVDEAVNELQTIQDMLRWSVSRFSAANIWYGHGTDNPWDEAVQLVLPSLYLPLDIP
EDMRTARLTSSEKHRIVERVIRRVNERIPVAYLTNKAWFCGHEFYVDERVLVPRSPIGEL
INNKFAGLISKQPQHILDMCTGSGCIAIACAYAFPDAEVDAVDISPDALAVAEQNIEEHG
LIHNVIPIRSDLFRDLPKVQYDLIVTNPPYVDAEDMSDLPNEYRHEPELGLASGTDGLKL
TRRILGNAADYLADDGVLICEVGNSMVHLMEQYPDVPFTWLEFDNGGDGVFMLTKEQLIA
AREHFAIYKD
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
gtggataaaattttcgttgatgaagcagtaaatgagctgcaaaccattcaggacatgttg
cgctggtcggtgagccgcttcagcgcggcaaatatctggtacggtcacggtaccgataac
ccgtgggatgaagccgtacagctggtgttgccttcgctctacctgccgctggatattccg
gaagatatgcgcaccgcgcgtctgacctccagcgaaaaacaccgtattgttgaacgcgtg
atccgccgcgtcaatgaacgcattccggtggcttacctgaccaacaaagcgtggttctgc
ggccatgaattttacgtcgatgaacgcgtgctggtgccgcgctcgccgattggtgaactg
atcaacaataaatttgccggacttatcagcaagcaaccgcagcatattttagatatgtgt
actggtagcggctgcatcgccattgcctgtgcttatgccttcccggatgcagaagtcgac
gcggtggatatctctccagacgcgctggcggttgctgaacagaacatcgaagaacacggt
ctgatccacaacgtcattccgattcgttccgatctgttccgcgacttgccgaaagtgcag
tacgacctgattgtcactaacccgccgtatgtcgatgcggaagatatgtccgacctgcca
aacgaataccgccacgagccggaactgggcctggcatctggcactgacggcctgaaactg
acgcgtcgcattctcggtaacgcggcagattaccttgctgatgatggcgtgttgatttgt
gaagtcggcaacagcatggtacatcttatggaacaatatccggatgttccgttcacctgg
ctggagtttgataacggcggcgatggtgtgtttatgctcaccaaagagcagcttattgcc
gcacgagaacatttcgcgatttataaagattaa

DBGET integrated database retrieval system