KEGG   Escherichia coli K-12 MG1655: b2331Help
Entry
b2331             CDS       T00007                                 

Gene name
smrB
Definition
(RefSeq) putative DNA endonuclease
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
2448606..2449157
Genome map
AA seq 183 aa AA seqDB search
MKKKTTLSEEDQALFRQLMAGTRKIKQDTIVHRPQRKKISEVPVKRLIQEQADASHYFSD
EFQPLLNTEGPVKYVRPDVSHFEAKKLRRGDYSPELFLDLHGLTQLQAKQELGALIAACR
REHVFCACVMHGHGKHILKQQTPLWLAQHPHVMAFHQAPKEYGGDAALLVLIEVEEWLPP
ELP
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaaacaacacttagcgaggaggaccaggctctgtttcgccagttgatggcg
gggactcgcaagattaagcaggacacgattgtccaccgaccgcagcgtaaaaaaatcagc
gaagtgccggtgaaacgcttgatccaggagcaggctgatgccagccattatttctccgat
gagtttcagccgttattaaataccgaaggtccggtgaaatatgttcgcccggatgtcagc
cattttgaggcgaagaaactgcgccgtggcgattattcgccggagttgtttttggattta
cacggtctgacgcagctgcaggccaagcaggaactgggggcgttgattgccgcctgccgc
cgtgaacatgtgttttgcgcctgcgtgatgcatgggcacgggaagcatattttgaagcaa
caaacaccgctgtggctggcacaacatccgcatgtgatggcctttcatcaggcaccaaaa
gagtatggcggtgatgcggcgttgttggtgttgattgaagtcgaagagtggctgccgccg
gagttgccctga

DBGET integrated database retrieval system