KEGG   Escherichia coli K-12 MG1655: b2334Help
Entry
b2334             CDS       T00007                                 

Gene name
yfcQ
Definition
(RefSeq) putative fimbrial-like adhesin protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fimbrial
Motif
Other DBs
NCBI-GeneID: 946779
NCBI-ProteinID: NP_416837
Pasteur: yfcQ
RegulonDB: ECK120003780
ECOCYC: G7205
ASAP: ABE-0007705
UniProt: P76500
Position
complement(2450587..2451075)
Genome map
AA seq 162 aa AA seqDB search
MRKTFLTLLCVSSAIAHAADEDITFHGTLLSPPTCSISGGKTIEVEFRDLIIDDINGNYG
RKEVPYELTCDSTTRHPDWEMTLTWTGTQTSFNDAAIETDVPGFGIELQHDGQRFKLNTP
LAINATDFTQKPKLEAVPVKASDAVLSDTNFSAYATLRVDYQ
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagactttcttaaccctgctttgtgtcagtagcgccatagctcatgctgctgat
gaagacatcacctttcacgggacattattgtcaccgccaacctgtagcatcagcggtggt
aaaaccattgaagtcgaatttcgcgatctcattatcgacgacatcaacggcaactatggt
cgtaaagaggtgccatatgaactcacttgtgactcgacgacccgtcatccagattgggag
atgaccctcacctggactggtacacaaaccagttttaatgatgcagcaattgaaactgat
gtacccggttttggtatcgagcttcagcacgatggtcagcgttttaaactcaatactccg
cttgctatcaacgccactgattttacgcaaaagccgaagctggaggccgtaccggtaaaa
gcgagtgatgctgtgttaagcgatacgaatttttcggcttacgcaacattacgggtggat
tatcaatga

DBGET integrated database retrieval system