KEGG   Escherichia coli K-12 MG1655: b2346Help
Entry
b2346             CDS       T00007                                 

Gene name
mlaA
Definition
(RefSeq) ABC transporter maintaining OM lipid asymmetry, OM lipoprotein component
  KO
K04754  
phospholipid-binding lipoprotein MlaA
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(2464252..2465007)
Genome map
AA seq 251 aa AA seqDB search
MKLRLSALALGTTLLVGCASSGTDQQGRSDPLEGFNRTMYNFNFNVLDPYIVRPVAVAWR
DYVPQPARNGLSNFTGNLEEPAVMVNYFLQGDPYQGMVHFTRFFLNTILGMGGFIDVAGM
ANPKLQRTEPHRFGSTLGHYGVGYGPYVQLPFYGSFTLRDDGGDMADGFYPVLSWLTWPM
SVGKWTLEGIETRAQLLDSDGLLRQSSDPYIMVREAYFQRHDFIANGGELKPQENPNAQA
IQDDLKDIDSE
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttcgcctgtcggcgcttgctctgggaactacgcttctggtggggtgtgcgagt
tccggtacagatcagcaagggcgttctgacccgttagaagggttcaaccgcaccatgtac
aacttcaacttcaatgtattagacccgtatattgttcgaccggtcgctgtcgcctggcgt
gattatgttccgcaaccggcgcgtaacggtttgagcaactttactggcaaccttgaagaa
cctgcggtgatggttaactacttcttgcagggcgacccttatcaggggatggtccacttt
acccgctttttcctgaacaccattttggggatgggcggttttattgatgttgcagggatg
gcgaacccgaaactgcaacggactgaacctcaccgcttcggtagtacgcttggtcattat
ggcgtgggttatgggccttacgttcagttaccgttctacggtagcttcacgctgcgtgat
gacggtggtgatatggcggatggtttttacccggttctttcctggctgacctggccgatg
tctgtgggtaaatggacgcttgaagggatcgaaacccgcgctcagctgctggattccgat
ggtctgctgcgtcagtcgtccgatccttatattatggtgcgcgaagcgtacttccagcgt
catgatttcatcgctaatggcggcgaactcaaaccgcaggaaaatccgaacgcacaagcg
attcaggatgatttaaaagatattgattctgaataa

DBGET integrated database retrieval system