KEGG   Escherichia coli K-12 MG1655: b2347Help
Entry
b2347             CDS       T00007                                 

Gene name
yfdC
Definition
(RefSeq) putative inner membrane protein
  KO
K21990  formate-nitrite transporter family protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Form_Nir_trans DUF3318
Motif
Other DBs
NCBI-GeneID: 944801
NCBI-ProteinID: NP_416849
Pasteur: yfdC
RegulonDB: ECK120003792
ECOCYC: G7217
ASAP: ABE-0007751
UniProt: P37327
Position
2465301..2466233
Genome map
AA seq 310 aa AA seqDB search
MDNDKIDQHSDEIEVESEEKERGKKIEIDEDRLPSRAMAIHEHIRQDGEKELERDAMALL
WSAIAAGLSMGASLLAKGIFQVELEGVPGSFLLENLGYTFGFIIVIMARQQLFTENTVTA
VLPVMQKPTMSNVGLLIRLWGVVLLGNILGTGIAAWAFEYMPIFNEETRDAFVKIGMDVM
KNTPSEMFANAIISGWLIATMVWMFPAAGAAKIVVIILMTWLIALGDTTHIVVGSVEILY
LVFNGTLHWSDFIWPFALPTLAGNICGGTFIFALMSHAQIRNDMSNKRKAEARQKAERAE
NIKKNYKNPA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggacaacgacaaaattgatcaacacagcgacgaaattgaagttgagagcgaagaaaaa
gagcgcggcaaaaaaatagaaatagatgaagaccgactcccctcccgggcgatggcaatt
catgagcatatccgccaggatggtgaaaaagagctggaacgcgacgcaatggcgctactg
tggtcagccattgcggcgggtctgtcgatgggcgcttcgttactggcaaaagggatattt
caagtcgaactggaaggtgtgccgggcagcttcttgctggagaatctcggttataccttt
ggttttattatcgtcattatggcccgccagcaattatttaccgaaaataccgtgactgcg
gtactacccgtcatgcaaaaaccgacaatgagcaacgtcggcttacttatacggttatgg
ggcgtcgtgctgctgggtaatattctcgggacaggtattgcggcgtgggcatttgaatat
atgcctatcttcaatgaagaaactcgcgatgcatttgtcaaaatcggcatggatgtgatg
aagaacacccccagcgagatgtttgccaacgcgatcatttccggctggctgatcgccact
atggtttggatgtttcctgcagcgggtgcggcaaagattgtggtgattatattgatgacc
tggcttattgccctgggtgacaccacccatatcgtggtcggttctgttgaaatcctctat
ctggtgtttaacggtacgctgcactggagcgatttcatctggcccttcgcactacctact
ttagcggggaacatctgcggcggcacctttatcttcgcgttaatgagtcatgcacagatt
cgtaacgacatgagcaataagcgtaaagcagaagcacgccaaaaagcagaacgtgcggaa
aacattaagaaaaattataaaaacccggcataa

DBGET integrated database retrieval system