KEGG   Escherichia coli K-12 MG1655: b2368Help
Entry
b2368             CDS       T00007                                 

Gene name
emrK
Definition
(RefSeq) EmrKY-TolC multidrug resistance efflux pump, membrane fusion protein component
  KO
K07797  
multidrug resistance protein K
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    b2368 (emrK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(2482176..2483339)
Genome map
AA seq 387 aa AA seqDB search
MEQINSNKKHSNRRKYFSLLAVVLFIAFSGAYAYWSMELEDMISTDDAYVTGNADPISAQ
VSGSVTVVNHKDTNYVRQGDILVSLDKTDATIALNKAKNNLANIVRQTNKLYLQDKQYSA
EVASARIQYQQSLEDYNRRVPLAKQGVISKETLEHTKDTLISSKAALNAAIQAYKANKAL
VMNTPLNRQPQVVEAADATKEAWLALKRTDIKSPVTGYIAQRSVQVGETVSPGQSLMAVV
PARQMWVNANFKETQLTDVRIGQSVNIISDLYGENVVFHGRVTGINMGTGNAFSLLPAQN
ATGNWIKIVQRVPVEVSLDPKELMEHPLRIGLSMTATIDTKNEDIAEMPELASTVTSMPA
YTSKALVIDTSPIEKEISNIISHNGQL
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
gtggaacagattaattcaaataaaaaacattctaacagaagaaaatacttttctttattg
gcggtagttttatttattgcgttttcaggtgcctatgcctattggtcaatggaattagaa
gacatgattagtacagatgacgcctatgtcacggggaatgcagatccaatttctgcacaa
gtctcaggtagtgtcactgtcgttaatcataaagatacgaactacgttcgacaaggtgac
attttagtttcactggataaaactgatgccactatcgcactcaataaagctaaaaataat
ctggcaaatattgttcggcaaacgaataaactatacttacaggataaacaatacagtgcc
gaagtcgcttcagcacgtattcagtatcaacaatctttagaagattataaccgtcgagtg
ccgttagcgaagcagggggttatttcaaaagaaacgctggagcataccaaagatacgtta
ataagtagcaaagcggcattgaatgccgctatccaggcttataaagcgaataaagcttta
gtaatgaacacaccattaaaccgtcagccacaagtcgttgaagcggcggatgcaactaaa
gaagcctggttggcgcttaaacgtacggatattaagagtccggttaccggctatattgcc
cagagaagtgttcaggtcggcgaaacagtgagccccggacaatcgttaatggctgtcgta
ccggcacgtcaaatgtgggttaatgccaactttaaagaaacacaactcacggatgtacgg
attggtcaatcggtcaatattatcagcgatctttatggtgaaaatgttgtgtttcatggt
cgggtgacagggatcaatatgggaaccggcaatgcgttctccttattacctgcacaaaat
gcgacagggaactggatcaaaatcgttcagcgtgtaccggttgaagtttctcttgatcca
aaagaactcatggaacaccccttgcgtattggtttatcgatgacagcaactattgatacg
aagaacgaagacattgccgagatgcctgagctggcttcaaccgtgacctccatgccggct
tataccagtaaggctttagttatcgataccagtccgatagaaaaagaaattagcaacatt
atttcgcataatggacaactttaa

DBGET integrated database retrieval system