KEGG   Escherichia coli K-12 MG1655: b2373Help
Entry
b2373             CDS       T00007                                 

Gene name
oxc
Definition
oxalyl CoA decarboxylase, ThDP-dependent
Orthology
K01577  
oxalyl-CoA decarboxylase [EC:4.1.1.8]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:eco00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2490256..2491950)
Genome map
AA seq 564 aa AA seqDB search
MSDQLQMTDGMHIIVEALKQNNIDTIYGVVGIPVTDMARHAQAEGIRYIGFRHEQSAGYA
AAASGFLTQKPGICLTVSAPGFLNGLTALANATVNGFPMIMISGSSDRAIVDLQQGDYEE
LDQMNAAKPYAKAAFRVNQPQDLGIALARAIRVSVSGRPGGVYLDLPANVLAATMEKDEA
LTTIVKVENPSPALLPCPKSVTSAISLLAKAERPLIILGKGAAYSQADEQLREFIESAQI
PFLPMSMAKGILEDTHPLSAAAARSFALANADVVMLVGARLNWLLAHGKKGWAADTQFIQ
LDIEPQEIDSNRPIAVPVVGDIASSMQGMLAELKQNTFTTPLVWRDILNIHKQQNAQKMH
EKLSTDTQPLNYFNALSAVRDVLRENQDIYLVNEGANTLDNARNIIDMYKPRRRLDCGTW
GVMGIGMGYAIGASVTSGSPVVAIEGDSAFGFSGMEIETICRYNLPVTIVIFNNGGIYRG
DGVDLSGAGAPSPTDLLHHARYDKLMDAFRGVGYNVTTTDELRHALTTGIQSRKPTIINV
VIDPAAGTESGHITKLNPKQVAGN
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatcaacttcaaatgacagatggtatgcatatcatcgttgaagcattaaaacag
aataatattgacactatttatggtgttgtaggtattcctgtgacggatatggcacgccat
gcccaggcggaaggcattcgttatattggttttcgtcatgagcagtcggcaggctatgcc
gctgcggcaagcggttttcttacccaaaaaccggggatctgcctgacagtttctgcgcca
ggattcctcaatggtttgaccgcattggccaacgcaacggtaaatggttttccgatgatc
atgattagcggctccagcgaccgcgcgatcgtcgacctacagcaaggtgattatgaagag
ctggaccaaatgaatgcggcaaaaccgtatgccaaagcagcatttcgcgttaatcagccg
caggatcttggcattgcattggcacgcgctatccgggtctctgtatcgggtcgccctggc
ggagtttatcttgatttgccagcaaatgtcctggccgcgacgatggaaaaagacgaagcg
ttaaccacgattgttaaagttgaaaatccgtcgccagcattattgccatgcccgaagtca
gtcactagcgcaatttcgcttttagcaaaagctgaacggccattaattatccttggcaaa
ggcgcggcgtattcacaagctgatgaacagcttcgtgaatttattgaaagtgctcagatt
ccattcctgccaatgtctatggcgaaagggatccttgaagatacgcatccactttctgcg
gcagctgcgcgttcgtttgccctggcaaatgctgacgttgtcatgcttgttggtgcacga
ctgaattggttattggcacacggtaaaaaaggatgggcggcagatacacagtttattcaa
ctggatattgaaccgcaggaaattgacagcaaccgccccattgctgtgccagtcgttggt
gatattgcatccagtatgcaaggtatgctggcagaactgaaacaaaacacatttacgact
ccactggtatggcgcgatattttaaatatccacaagcagcaaaatgcacaaaaaatgcat
gaaaaattaagtacagatactcaaccattaaattactttaatgcattaagtgctgtgcgc
gacgtattgcgcgagaaccaggatatttatttagttaatgaaggtgcaaataccctggat
aatgcacgaaatattattgatatgtataaaccacgtcgtcgtctggattgtggtacctgg
ggtgtcatgggcatcggtatgggctatgccatcggtgctagcgtgacttctggttctccg
gttgtcgccattgaaggtgatagtgcttttggtttcagtgggatggaaattgaaacgatt
tgtcgatataacctgccggtgacgatcgttatttttaataatggcggcatctacagagga
gacggtgttgatctcagtggcgctggtgcaccatcaccaacggatctgttgcaccatgca
aggtatgacaaattaatggatgcgtttcgtggcgttggctataacgtcaccacgacagat
gaacttcgtcatgctttaaccaccggtattcagtcgcgcaaaccgaccattattaatgtg
gtcatcgaccctgcagcaggaactgaaagtggccatattaccaaacttaacccaaaacaa
gtcgctggtaattaa

DBGET integrated database retrieval system