KEGG   Escherichia coli K-12 MG1655: b2406Help
Entry
b2406             CDS       T00007                                 

Gene name
xapB
Definition
(RefSeq) xanthosine transporter
  KO
K11537  
MFS transporter, NHS family, xanthosine permease
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Major Facilitator Superfamily (MFS)
  Sugar transporters
   Nucleoside:H+ symporter (NHS) family [TC:2.A.1.10]
    b2406 (xapB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(2522729..2523985)
Genome map
AA seq 418 aa AA seqDB search
MSIAMRLKVMSFLQYFIWGSWLVTLGSYMINTLHFTGANVGMVYSSKGIAAIIMPGIMGI
IADKWLRAERAYMLCHLVCAGVLFYAASVTDPDMMFWVMLVNAMAFMPTIALSNSVSYSC
LAQAGLDPVTAFPPIRVFGTVGFIVAMWAVSLLHLELSSLQLYIASGASLLLSAYALTLP
KIPVAEKKATTSLASKLGLDAFVLFKNPRMAIFFLFAMMLGAVLQITNVFGNPFLHDFAR
NPEFADSFVVKYPSILLSVSQMAEVGFILTIPFFLKRFGIKTVMLMSMVAWTLRFGFFAY
GDPSTTGFILLLLSMIVYGCAFDFFNISGSVFVEQEVDSSIRASAQGLFMTMVNGVGAWV
GSILSGMAVDYFSVDGVKDWQTIWLVFAGYALFLAVIFFFGFKYNHDPEKIKHRAVTH
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcgcgatgcgcttaaaggtaatgtcctttttgcaatattttatctgggggagc
tggctggttaccctcggctcttacatgattaatactcttcatttcaccggcgctaatgtt
ggcatggtttacagttccaaagggatcgccgcgattattatgcctggtataatggggatc
atcgcagacaaatggctgcgcgcagaacgtgcatacatgctgtgtcacctggtgtgtgcg
ggcgtacttttttatgcggcatccgtaactgatccggatatgatgttttgggtgatgtta
gtcaatgcgatggcgtttatgccgactattgcgttatcgaacagcgtctcttattcctgt
cttgcccaggcagggcttgacccggtgaccgctttcccgcccattcgcgtttttggtacg
gtggggttcattgtcgcgatgtgggcagtaagcctgctgcatctggaattgagtagtctg
cagctgtatatcgcgtccggtgcgtcattgctgctgtcggcttatgcgctgactttgccg
aagattccggttgcggagaaaaaagcgaccacatcgcttgccagcaagctgggtctggat
gccttcgtgctgtttaaaaatccacgcatggccatctttttcctctttgccatgatgctg
ggtgcggtactgcaaattaccaacgtttttggtaatccgttcctacatgatttcgcccgt
aacccggagtttgctgacagttttgtggtgaaatatccctccattttactgtcagtttca
cagatggcagaagtgggctttatactgactatcccattctttttaaagcgatttggcatt
aaaaccgtcatgctgatgagtatggtggcctggacgctgcgctttggcttcttcgcctat
ggcgatccgtcaacaaccggatttattttgctgctgctgtcgatgattgtttatggctgt
gcattcgatttcttcaatatttctggttcggtatttgtcgaacaggaagttgattccagc
attcgtgccagcgcgcaggggctctttatgaccatggtaaatggtgtcggcgcatgggtt
ggctcgattctgagtggcatggcagtagattacttttcggtggatggcgtaaaagactgg
caaactatctggctggtgtttgcaggatatgctctttttctcgcagtgatatttttcttt
gggtttaaatataatcatgaccctgaaaagataaagcatcgagcggtgactcattaa

DBGET integrated database retrieval system