KEGG   Escherichia coli K-12 MG1655: b2413Help
Entry
b2413             CDS       T00007                                 

Gene name
cysZ
Definition
(RefSeq) EI24 family inner membrane protein; putative sulfate transporter
  KO
K06203  
CysZ protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
2531463..2532224
Genome map
AA seq 253 aa AA seqDB search
MVSSFTSAPRSGFYYFAQGWKLVSQPGIRRFVILPLLVNILLMGGAFWWLFTQLDVWIPT
LMSYVPDWLQWLSYLLWPLAVISVLLVFGYFFSTIANWIAAPFNGLLAEQLEARLTGATP
PDTGIFGIMKDVPRIMKREWQKFAWYLPRAIVLLILYFIPGIGQTVAPVLWFLFSAWMLA
IQYCDYPFDNHKVPFKEMRTALRTRKITNMQFGALTSLFTMIPLLNLFIMPVAVCGATAM
WVDCYRDKHAMWR
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggtttcatcattcacatctgccccacgcagcggtttttactattttgcgcaaggctgg
aagctcgtctcgcaacctgggattcggcgtttcgttattttaccgctgctggtcaatatt
ttgttgatggggggcgcattctggtggctctttacacagctcgatgtctggatcccgact
ctcatgagttacgttccggactggctacaatggctgagttatctgttgtggcctctggct
gtcatctctgtgctgttagtgtttggctatttcttctccacgattgctaactggattgcc
gctccgtttaacggtttattggctgaacaactggaagcacgattgactggcgctacaccg
ccagataccgggattttcggtatcatgaaagatgtgccgcgaatcatgaaacgcgaatgg
caaaaatttgcctggtatctgccgcgcgcaattgtattactaattctttacttcatccct
ggtattgggcaaaccgtcgcgccggtactgtggttcctgtttagcgcctggatgttagcc
atccagtattgcgattaccccttcgataaccacaaagtgccgtttaaagagatgcgcacc
gccctgcgcacacgcaaaatcaccaatatgcagtttggtgctttaaccagcctgtttacg
atgatcccgctgcttaatctgttcatcatgcccgttgccgtttgtggcgcgacggcgatg
tgggtcgattgctatcgcgataaacacgcgatgtggcggtaa

DBGET integrated database retrieval system