KEGG   Escherichia coli K-12 MG1655: b2413Help
Entry
b2413             CDS       T00007                                 

Gene name
cysZ
Definition
(RefSeq) sulfate transporter, sulfite inhibited
  KO
K06203  CysZ protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EI24 Pacs-1
Motif
Other DBs
NCBI-GeneID: 946875
NCBI-ProteinID: NP_416908
Pasteur: cysZ
RegulonDB: ECK120000003
ECOCYC: EG10003
ASAP: ABE-0007953
UniProt: P0A6J3
Position
2531463..2532224
Genome map
AA seq 253 aa AA seqDB search
MVSSFTSAPRSGFYYFAQGWKLVSQPGIRRFVILPLLVNILLMGGAFWWLFTQLDVWIPT
LMSYVPDWLQWLSYLLWPLAVISVLLVFGYFFSTIANWIAAPFNGLLAEQLEARLTGATP
PDTGIFGIMKDVPRIMKREWQKFAWYLPRAIVLLILYFIPGIGQTVAPVLWFLFSAWMLA
IQYCDYPFDNHKVPFKEMRTALRTRKITNMQFGALTSLFTMIPLLNLFIMPVAVCGATAM
WVDCYRDKHAMWR
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggtttcatcattcacatctgccccacgcagcggtttttactattttgcgcaaggctgg
aagctcgtctcgcaacctgggattcggcgtttcgttattttaccgctgctggtcaatatt
ttgttgatggggggcgcattctggtggctctttacacagctcgatgtctggatcccgact
ctcatgagttacgttccggactggctacaatggctgagttatctgttgtggcctctggct
gtcatctctgtgctgttagtgtttggctatttcttctccacgattgctaactggattgcc
gctccgtttaacggtttattggctgaacaactggaagcacgattgactggcgctacaccg
ccagataccgggattttcggtatcatgaaagatgtgccgcgaatcatgaaacgcgaatgg
caaaaatttgcctggtatctgccgcgcgcaattgtattactaattctttacttcatccct
ggtattgggcaaaccgtcgcgccggtactgtggttcctgtttagcgcctggatgttagcc
atccagtattgcgattaccccttcgataaccacaaagtgccgtttaaagagatgcgcacc
gccctgcgcacacgcaaaatcaccaatatgcagtttggtgctttaaccagcctgtttacg
atgatcccgctgcttaatctgttcatcatgcccgttgccgtttgtggcgcgacggcgatg
tgggtcgattgctatcgcgataaacacgcgatgtggcggtaa

DBGET integrated database retrieval system