KEGG   Escherichia coli K-12 MG1655: b2414Help
Entry
b2414             CDS       T00007                                 

Gene name
cysK
Definition
(RefSeq) cysteine synthase A, O-acetylserine sulfhydrolase A subunit (EC:2.5.1.47)
  KO
K01738  
cysteine synthase A [EC:2.5.1.47]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Cysteine and methionine metabolism
Sulfur metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    b2414 (cysK)
   01230 Biosynthesis of amino acids
    b2414 (cysK)
  Energy metabolism
   00920 Sulfur metabolism
    b2414 (cysK)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    b2414 (cysK)
Enzymes [BR:eco01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     b2414 (cysK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
2532409..2533380
Genome map
AA seq 323 aa AA seqDB search
MSKIFEDNSLTIGHTPLVRLNRIGNGRILAKVESRNPSFSVKCRIGANMIWDAEKRGVLK
PGVELVEPTSGNTGIALAYVAAARGYKLTLTMPETMSIERRKLLKALGANLVLTEGAKGM
KGAIQKAEEIVASNPEKYLLLQQFSNPANPEIHEKTTGPEIWEDTDGQVDVFIAGVGTGG
TLTGVSRYIKGTKGKTDLISVAVEPTDSPVIAQALAGEEIKPGPHKIQGIGAGFIPANLD
LKLVDKVIGITNEEAISTARRLMEEEGILAGISSGAAVAAALKLQEDESFTNKNIVVILP
SSGERYLSTALFADLFTEKELQQ
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagatttttgaagataactcgctgactatcggtcacacgccgctggttcgcctg
aatcgcatcggtaacggacgcattctggcgaaggtggaatctcgtaaccccagcttcagc
gttaagtgccgtatcggtgccaacatgatttgggatgccgaaaagcgcggcgtgctgaaa
ccaggcgttgaactggttgaaccgaccagcggtaataccgggattgcactggcctatgta
gctgccgctcgcggttacaaactcaccctgaccatgccagaaaccatgagtattgaacgc
cgcaagctgctgaaagcgttaggtgcaaacctggtgctgacggaaggtgctaaaggcatg
aaaggcgcaatccaaaaagcagaagaaattgtcgccagcaatccagagaaatacctgctg
ctgcaacaattcagcaatccggcaaaccctgaaattcacgaaaagaccaccggtccggag
atatgggaagataccgacggtcaggttgatgtatttattgctggcgttgggactggcggt
acgctgactggcgtcagccgctacattaaaggcaccaaaggcaagaccgatcttatctct
gtcgccgttgagccaaccgattctccagttatcgcccaggcgctggcaggtgaagagatt
aaacctggcccgcataaaattcagggtattggcgctggttttatcccggctaacctcgat
ctcaagctggtcgataaagtcattggcatcaccaatgaagaagcgatttctaccgcgcgt
cgtctgatggaagaagaaggtattcttgcaggtatctcttctggagcagctgttgccgcg
gcgttgaaactacaagaagatgaaagctttaccaacaagaatattgtggttattctacca
tcatcgggtgagcgttatttaagcaccgcattgtttgccgatctcttcactgagaaagaa
ttgcaacagtaa

DBGET integrated database retrieval system