KEGG   Escherichia coli K-12 MG1655: b2416Help
Entry
b2416             CDS       T00007                                 

Gene name
ptsI
Definition
(RefSeq) PEP-protein phosphotransferase of PTS system (enzyme I) (EC:2.7.3.9)
  KO
K08483  
phosphotransferase system, enzyme I, PtsI [EC:2.7.3.9]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    b2416 (ptsI)
Enzymes [BR:eco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.9  phosphoenolpyruvate---protein phosphotransferase
     b2416 (ptsI)
Transporters [BR:eco02000]
 Phosphotransferase System (PTS)
  Enzyme I and HPr
   Enzyme I [TC:8.A.7]
    b2416 (ptsI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
2534066..2535793
Genome map
AA seq 575 aa AA seqDB search
MISGILASPGIAFGKALLLKEDEIVIDRKKISADQVDQEVERFLSGRAKASAQLETIKTK
AGETFGEEKEAIFEGHIMLLEDEELEQEIIALIKDKHMTADAAAHEVIEGQASALEELDD
EYLKERAADVRDIGKRLLRNILGLKIIDLSAIQDEVILVAADLTPSETAQLNLKKVLGFI
TDAGGRTSHTSIMARSLELPAIVGTGSVTSQVKNDDYLILDAVNNQVYVNPTNEVIDKMR
AVQEQVASEKAELAKLKDLPAITLDGHQVEVCANIGTVRDVEGAERNGAEGVGLYRTEFL
FMDRDALPTEEEQFAAYKAVAEACGSQAVIVRTMDIGGDKELPYMNFPKEENPFLGWRAI
RIAMDRREILRDQLRAILRASAFGKLRIMFPMIISVEEVRALRKEIEIYKQELRDEGKAF
DESIEIGVMVETPAAATIARHLAKEVDFFSIGTNDLTQYTLAVDRGNDMISHLYQPMSPS
VLNLIKQVIDASHAEGKWTGMCGELAGDERATLLLLGMGLDEFSMSAISIPRIKKIIRNT
NFEDAKVLAEQALAQPTTDELMTLVNKFIEEKTIC
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgatttcaggcattttagcatccccgggtatcgctttcggtaaagctctgcttctgaaa
gaagacgaaattgtcattgaccggaaaaaaatttctgccgaccaggttgatcaggaagtt
gaacgttttctgagcggtcgtgccaaggcatcagcccagctggaaacgatcaaaacgaaa
gctggtgaaacgttcggtgaagaaaaagaagccatctttgaagggcatattatgctgctc
gaagatgaggagctggagcaggaaatcatagccctgattaaagataagcacatgacagct
gacgcagctgctcatgaagttatcgaaggtcaggcttctgccctggaagagctggatgat
gaatacctgaaagaacgtgcggctgacgtacgtgatatcggtaagcgcctgctgcgcaac
atcctgggcctgaagattatcgacctgagcgccattcaggatgaagtcattctggttgcc
gctgacctgacgccgtccgaaaccgcacagctgaacctgaagaaggtgctgggtttcatc
accgacgcgggtggccgtacttcccacacctctatcatggcgcgttctctggaactacct
gctatcgtgggtaccggtagcgtcacctctcaggtgaaaaatgacgactatctgattctg
gatgccgtaaataatcaggtttacgtcaatccaaccaacgaagttattgataaaatgcgc
gctgttcaggagcaagtggcttctgaaaaagcagagcttgctaaactgaaagatctgcca
gctattacgctggacggtcaccaggtagaagtatgcgctaacattggtacggttcgtgac
gttgaaggtgcagagcgtaacggcgctgaaggcgttggtctgtatcgtactgagttcctg
ttcatggaccgcgacgcactgcccactgaagaagaacagtttgctgcttacaaagcagtg
gctgaagcgtgtggctcgcaagcggttatcgttcgtaccatggacatcggcggcgacaaa
gagctgccatacatgaacttcccgaaagaagagaacccgttcctcggctggcgcgctatc
cgtatcgcgatggatcgtagagagatcctgcgcgatcagctccgcgctatcctgcgtgcc
tcggctttcggtaaattgcgcattatgttcccgatgatcatctctgttgaagaagtgcgt
gcactgcgcaaagagatcgaaatctacaaacaggaactgcgcgacgaaggtaaagcgttt
gacgagtcaattgaaatcggcgtaatggtggaaacaccggctgccgcaacaattgcacgt
catttagccaaagaagttgatttctttagtatcggcaccaatgatttaacgcagtacact
ctggcagttgaccgtggtaatgatatgatttcacacctttaccagccaatgtcaccgtcc
gtgctgaacttgatcaagcaagttattgatgcttctcatgctgaaggcaaatggactggc
atgtgtggtgagcttgctggcgatgaacgtgctacacttctgttgctggggatgggtctg
gacgaattctctatgagcgccatttctatcccgcgcattaagaagattatccgtaacacg
aacttcgaagatgcgaaggtgttagcagagcaggctcttgctcaaccgacaacggacgag
ttaatgacgctggttaacaagttcattgaagaaaaaacaatctgctaa

DBGET integrated database retrieval system