KEGG   Escherichia coli K-12 MG1655: b2418Help
Entry
b2418             CDS       T00007                                 

Gene name
pdxK
Definition
(RefSeq) pyridoxal-pyridoxamine kinase/hydroxymethylpyrimidine kinase (EC:2.7.1.35)
  KO
K00868  
pyridoxine kinase [EC:2.7.1.35]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Vitamin B6 metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    b2418 (pdxK)
Enzymes [BR:eco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.35  pyridoxal kinase
     b2418 (pdxK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2536386..2537237)
Genome map
AA seq 283 aa AA seqDB search
MSSLLLFNDKSRALQADIVAVQSQVVYGSVGNSIAVPAIKQNGLNVFAVPTVLLSNTPHY
DTFYGGAIPDEWFSGYLRALQERDALRQLRAVTTGYMGTASQIKILAEWLTALRKDHPDL
LIMVDPVIGDIDSGIYVKPDLPEAYRQYLLPLAQGITPNIFELEILTGKNCRDLDSAIAA
AKSLLSDTLKWVVVTSASGNEENQEMQVVVVTADSVNVISHSRVKTDLKGTGDLFCAQLI
SGLLKGKALTDAVHRAGLRVLEVMRYTQQHESDELILPPLAEA
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtttgttgttgtttaacgataagagtagggcactgcaggcggatatcgtcgcc
gtgcagtcgcaggtggtttacggcagcgtgggcaacagcattgccgtgcctgctatcaaa
cagaacggcctgaatgtctttgccgtgccgacggtattgctgagcaatacgccgcattat
gacactttctacggtggtgcgattccggacgaatggtttagcggctatttgcgtgcgctt
caggagcgtgatgcgctgcgccaacttcgtgctgtaaccacgggctatatgggaacggca
tcgcaaatcaaaatccttgccgagtggctgactgcgctacgcaaagaccatcctgaccta
ttgatcatggtcgatccggtgattggcgatattgatagcggaatttatgtcaaacctgac
cttcccgaagcgtatcgacaatatttactgccgctggcgcagggaattacccccaatatc
tttgagttggaaatcctgaccggtaaaaattgccgcgatctcgacagtgccattgctgcc
gcaaaaagtctgctttcagacacattaaaatgggtggtggttaccagcgcctccggtaat
gaagaaaatcaggagatgcaggttgtggtggtcactgccgacagcgtgaatgtcatttcc
cattcacgggtaaaaaccgacctgaaagggactggcgacctgttttgtgctcagctcatc
agtggcttgctgaaagggaaggcgttaaccgatgcagtgcaccgagcggggttgcgcgta
ctggaagtgatgcgctacacccagcagcatgagagcgatgaattgattttgccgccgctg
gcggaagcataa

DBGET integrated database retrieval system