KEGG   Escherichia coli K-12 MG1655: b2423Help
Entry
b2423             CDS       T00007                                 

Gene name
cysW
Definition
(RefSeq) sulfate/thiosulfate ABC transporter subunit
  KO
K02047  
sulfate transport system permease protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Sulfur metabolism
ABC transporters
Module
Sulfate transport system
Sulfate-sulfur assimilation
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    b2423 (cysW)
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b2423 (cysW)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Sulfate transporter [MD:M00185] [OT]
    b2423 (cysW)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(2540804..2541679)
Genome map
AA seq 291 aa AA seqDB search
MAEVTQLKRYDARPINWGKWFLIGIGMLVSAFILLVPMIYIFVQAFSKGLMPVLQNLADP
DMLHAIWLTVMIALIAVPVNLVFGILLAWLVTRFNFPGRQLLLTLLDIPFAVSPVVAGLV
YLLFYGSNGPLGGWLDEHNLQIMFSWPGMVLVTIFVTCPFVVRELVPVMLSQGSQEDEAA
ILLGASGWQMFRRVTLPNIRWALLYGVVLTNARAIGEFGAVSVVSGSIRGETLSLPLQIE
LLEQDYNTVGSFTAAALLTLMAIITLFLKSMLQWRLENQEKRAQQEEHHEH
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagttacccaattgaagcgttatgacgcgcgcccgattaactggggcaaatgg
tttctgattggcatcgggatgctggtttcggcgttcatcctgctggtgccgatgatttac
atcttcgtgcaggcattcagcaaggggctgatgccggttttacagaatctggccgatccg
gacatgctgcacgccatctggctgacggtgatgatcgcgctgattgccgtaccggtaaac
ctggtgttcggcattctgctggcctggctggtgacgcgctttaacttccctggacgccag
ttactgctgacgctactggacattccgtttgccgtatcgccggtggttgccggtctggtg
tatttgctgttctacggctctaacggcccgctcggcggttggctcgacgagcataacctg
caaattatgttctcctggccgggaatggtgctggtcaccatcttcgtgacgtgtccgttt
gtggtgcgcgaactggtgccggtgatgttaagccagggcagccaggaagacgaagcggcg
attttgcttggcgcgtccggctggcagatgttccgtcgcgtcacattaccgaacatccgc
tgggcgctgctttatggcgtggtgttgaccaacgcccgcgcaattggcgagtttggcgcg
gtgtcggtggtttccggctcgattcgcggcgaaaccctgtcgctgccgttacagattgaa
ttgctggagcaggactacaacaccgtcggctcctttaccgctgcggcgctgttaacgctg
atggcgattatcaccctgtttttaaaaagtatgttgcagtggcgcctggagaatcaggaa
aaacgcgcacagcaggaggaacatcatgagcattga

DBGET integrated database retrieval system