KEGG   Escherichia coli K-12 MG1655: b2428Help
Entry
b2428             CDS       T00007                                 

Gene name
murQ
Definition
(RefSeq) N-acetylmuramic acid 6-phosphate (MurNAc-6-P) etherase
  KO
K07106  
N-acetylmuramic acid 6-phosphate etherase [EC:4.2.1.126]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    b2428 (murQ)
Enzymes [BR:eco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.126  N-acetylmuramic acid 6-phosphate etherase
     b2428 (murQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
2545773..2546669
Genome map
AA seq 298 aa AA seqDB search
MQFEKMITEGSNTASAEIDRVSTLEMCRIINDEDKTVPLAVERVLPDIAAAIDVIHAQVS
GGGRLIYLGAGTSGRLGILDASECPPTYGVKPGLVVGLIAGGEYAIQHAVEGAEDSREGG
VNDLKNINLTAQDVVVGIAASGRTPYVIAGLEYARQLGCRTVGISCNPGSAVSTTAEFAI
TPIVGAEVVTGSSRMKAGTAQKLVLNMLSTGLMIKSGKVFGNLMVDVVATNEKLHVRQVN
IVKNATGCSAEQAEAALIACERNCKTAIVMVLKNLDAAEAKKRLDQHGGFIRQVLDKE
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgcaatttgaaaagatgattactgaaggctcgaacaccgcctcggctgaaattgaccgc
gtatcgacgctggaaatgtgccggattatcaacgatgaagataaaaccgtaccgcttgcc
gttgagcgcgtactgccggatatcgccgcggcgatcgatgttatccacgcccaggtaagc
ggcggcgggcgtctgatttacctcggtgcgggaacatccggtcgtctggggattctggat
gccagcgaatgtccgcccacctacggcgtgaaaccgggtctggtggttggtttgattgct
ggcggcgaatatgccattcagcacgcggtggaaggcgcggaagatagccgggaaggcggt
gttaatgatctgaaaaatattaatttaacggcacaggatgtggtggttggcattgctgcc
agcggtcgcacgccgtatgtgattgccggactggaatacgcacgccagctcggctgccgc
acagtgggaatttcctgtaatccggggagcgccgtttcaaccaccgctgagtttgccatt
acaccgattgtaggtgccgaagttgttaccggttcttcgcggatgaaagcaggtacagcg
cagaaactggtgctcaatatgctttccaccgggctgatgattaaatccggcaaagtgttc
ggcaacctgatggtcgatgtggtcgccaccaacgaaaaactgcatgtgcgacaggtcaat
attgttaaaaacgccaccggatgtagcgcagagcaagcggaagcggcgttaattgcttgc
gagcgcaactgtaaaacggccattgtgatggtgctgaaaaatctcgatgccgcagaagct
aaaaaacgcctggatcaacacggcggctttattcgtcaggttttagacaaggaataa

DBGET integrated database retrieval system