KEGG   Escherichia coli K-12 MG1655: b2458Help
Entry
b2458             CDS       T00007                                 

Gene name
eutD
Definition
(RefSeq) phosphate acetyltransferase
  KO
K04020  
phosphotransacetylase
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Pyruvate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    b2458 (eutD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2572489..2573505)
Genome map
AA seq 338 aa AA seqDB search
MIIERCRELALRAPARVVFPDALDQRVLKAAQYLHQQGLATPILVANPFELRQFALSHGV
AMDGLQVIDPHGNLAMREEFAHRWLARAGEKTPPDALEKLTDPLMFAAAMVSAGKADVCI
AGNLSSTANVLRAGLRIIGLQPGCKTLSSIFLMLPQYSGPALGFADCSVVPQPTAAQLAD
IALASAETWRAITGEEPRVAMLSFSSNGSARHPCVANVQQATEIVRERAPKLVVDGELQF
DAAFVPEVAAQKAPASPLQGKANVMVFPSLEAGNIGYKIAQRLGGYRAVGPLIQGLAAPM
HDLSRGCSVQEIIELALVAAVPRQTEVNRESSLQTLVE
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgattattgaacgttgtcgtgaactggcgttgcgagcgcccgccagagtggtttttccg
gatgcgttagaccaacgtgtgctgaaagccgcgcaatatttacatcaacaaggtctggca
acgcccattctggtcgccaatccgtttgaacttcgtcagtttgcgctcagtcacggcgtg
gcgatggacgggctacaggtgattgatccgcatggcaacctcgcaatgcgggaagaattt
gctcatcgctggctggcccgcgcgggcgaaaaaacgccgccggatgcgctggaaaaactt
accgaccctctgatgttcgccgcagcaatggtcagcgccggtaaagcggatgtctgtatc
gcgggcaacctctcttccacggcaaatgtgctgcgtgccggattacgcattatcggcttg
cagccaggctgtaaaacgctctcttccattttcctgatgttgccacagtacagcggcccg
gcgttgggctttgccgattgcagcgtggtgccacagccgacggcggcgcagctggcggat
atcgcgcttgccagtgccgaaacctggcgcgccatcaccggagaagagccgcgcgtggcg
atgctgtcgttttccagcaatggtagcgcccgtcacccctgtgttgctaacgtccagcag
gcgacagaaatcgtccgtgagcgcgcaccaaagctggtggtggatggcgagttacagttt
gacgccgccttcgtgccggaagtggcggcgcaaaaagcgcctgccagcccgctacagggc
aaggccaatgtgatggtttttccgtcgctggaagccggaaatattggttacaaaatcgca
caacgactcggcggatatcgtgccgtcgggccactgatacaaggacttgccgcgccgatg
cacgatctctctcgtggttgtagcgtgcaggaaattatcgagctggcgctggtggcagct
gtgccgcgtcagacagaagtgaaccgcgaaagcagtttacaaacactggttgaatga

DBGET integrated database retrieval system