KEGG   Escherichia coli K-12 MG1655: b2470Help
Entry
b2470             CDS       T00007                                 

Gene name
acrD
Definition
(RefSeq) aminoglycoside/multidrug efflux system
  KO
K18324  
multidrug efflux pump
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Two-component system
Module
Multidrug resistance, efflux pump AcrAD-TolC
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    b2470 (acrD)
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b2470 (acrD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
2587595..2590708
Genome map
AA seq 1037 aa AA seqDB search
MANFFIDRPIFAWVLAILLCLTGTLAIFSLPVEQYPDLAPPNVRVTANYPGASAQTLENT
VTQVIEQNMTGLDNLMYMSSQSSGTGQASVTLSFKAGTDPDEAVQQVQNQLQSAMRKLPQ
AVQNQGVTVRKTGDTNILTIAFVSTDGSMDKQDIADYVASNIQDPLSRVNGVGDIDAYGS
QYSMRIWLDPAKLNSFQMTAKDVTDAIESQNAQIAVGQLGGTPSVDKQALNATINAQSLL
QTPEQFRDITLRVNQDGSEVRLGDVATVEMGAEKYDYLSRFNGKPASGLGVKLASGANEM
ATAELVLNRLDELAQYFPHGLEYKVAYETTSFVKASIEDVVKTLLEAIALVFLVMYLFLQ
NFRATLIPTIAVPVVLMGTFSVLYAFGYSVNTLTMFAMVLAIGLLVDDAIVVVENVERIM
SEEGLTPREATRKSMGQIQGALVGIAMVLSAVFVPMAFFGGTTGAIYRQFSITIVAAMVL
SVLVAMILTPALCATLLKPLKKGEHHGQKGFFAWFNQMFNRNAERYEKGVAKILHRSLRW
IVIYVLLLGGMVFLFLRLPTSFLPLEDRGMFTTSVQLPSGSTQQQTLKVVEQIEKYYFTH
EKDNIMSVFATVGSGPGGNGQNVARMFIRLKDWSERDSKTGTSFAIIERATKAFNQIKEA
RVIASSPPAISGLGSSAGFDMELQDHAGAGHDALMAARNQLLALAAENPELTRVRHNGLD
DSPQLQIDIDQRKAQALGVAIDDINDTLQTAWGSSYVNDFMDRGRVKKVYVQAAAPYRML
PDDINLWYVRNKDGGMVPFSAFATSRWETGSPRLERYNGYSAVEIVGEAAPGVSTGTAMD
IMESLVKQLPNGFGLEWTAMSYQERLSGAQAPALYAISLLVVFLCLAALYESWSVPFSVM
LVVPLGVIGALLATWMRGLENDVYFQVGLLTVIGLSAKNAILIVEFANEMNQKGHDLFEA
TLHACRQRLRPILMTSLAFIFGVLPMATSTGAGSGGQHAVGTGVMGGMISATILAIYFVP
LFFVLVRRRFPLKPRPE
NT seq 3114 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatttctttattgatcgccccatttttgcctgggtgctggcaatcctgttgtgt
ctgacaggtaccctggcgattttttcattgcccgttgaacaataccccgatctcgcgcca
ccgaatgtgcgagtgaccgctaactatcccggcgcatcggcccagacgctggaaaacacc
gtgacccaggttatcgagcaaaatatgaccggcctcgataatctcatgtatatgtcatct
cagagcagtggcaccggtcaggcatctgtcactttaagttttaaagcaggcaccgatccg
gacgaagccgtgcagcaagtacaaaaccagctgcaatcagccatgcgaaagttaccgcag
gcggtgcaaaatcagggcgtgacggtgcgtaaaaccggcgataccaacattctgaccatt
gccttcgtctctaccgatggttcgatggataaacaggatattgctgattatgttgccagt
aatattcaggacccgttaagccgcgtgaatggcgtcggggatatcgatgcctatggttcg
caatattccatgcgtatctggctggacccggcgaaactcaacagtttccagatgacggct
aaagatgtcactgatgccattgagtcacagaacgcgcagattgcggttgggcaacttggt
ggtacaccttccgtcgataagcaggcgctcaacgccaccattaacgcccagtcactgctg
caaacaccagaacagttccgcgatatcaccttgcgggtcaatcaggacggctcagaggta
aggctgggcgatgtcgccaccgtcgaaatgggggcggagaaatacgattatcttagccgc
ttcaatggtaagccagcctccgggctgggggtaaaactggcctccggcgctaacgaaatg
gcgacagcggagctggtgctcaatcgtctcgacgagctggcgcagtatttcccgcatgga
ctggaatacaaggtggcgtatgaaaccacctcgtttgttaaagcctccattgaagacgtg
gtgaaaacgctgctggaagctatcgctctggttttcctcgttatgtatctgttcctgcaa
aacttccgcgccacgctgatacccactatcgccgtgccggtggtgttgatgggaaccttc
tccgtactttacgccttcggttacagcgtcaacaccttaaccatgttcgcgatggtgctg
gcgatcggtctgctggtggatgacgccatcgtggtggtggaaaacgtcgaacgtattatg
agtgaggaaggactcactcctcgcgaagccacacgtaaatcgatggggcagatccagggg
gcactggtcgggattgcgatggttctttcggcggtatttgtaccaatggccttcttcggc
ggcaccaccggtgccatctatcgccagttctctattaccattgttgcggcgatggtgctg
tcagtactggtagcgatgatcctcactccggctctgtgtgccacactacttaagccactg
aaaaaaggtgagcatcatgggcaaaaaggcttttttgcctggtttaaccagatgtttaac
cgcaacgccgaacgctacgaaaaaggggtggcgaaaattctccaccgtagcctgcgctgg
attgtgatttatgtcctgctgcttggcggcatggtgttcctgttcctgcgtttgccgacg
tcgttcttaccgctggaagaccgtggcatgtttactacctcggtacagttgcccagcggt
tcaacgcaacaacagaccctgaaagtcgttgagcaaatcgagaaatactacttcacccat
gaaaaagacaacatcatgtcggtgtttgccaccgttggttctggccctgggggtaacggg
caaaacgtggcgcgaatgtttatccgcctgaaagactggagcgaacgcgacagtaagacc
ggcacctcgtttgccattatcgagcgtgcaacgaaggcgtttaaccaaattaaagaagct
cgcgttatcgccagcagcccgccagcaattagcggtcttggtagttctgcaggttttgat
atggagttgcaggaccacgctggagcgggtcacgatgcgctgatggcagcacgtaatcag
ttgctggcgctggcggcggaaaacccggagctaacccgtgtgcgccataacggcctcgac
gacagtccgcagttgcagattgatatcgaccagcgtaaagctcaggcgctgggcgttgct
atcgacgatattaacgacacactgcaaaccgcctggggttcgagctatgtgaatgacttt
atggatcgcggtcgcgtgaagaaagtctatgtgcaggcagctgcgccgtatcgcatgctg
ccagatgacatcaatctctggtatgtccgaaataaagatggcggcatggtgcccttctct
gctttcgcgacctcacgctgggaaacaggctcgccgcgtctggaacgctataacggttat
tctgcggttgagattgttggggaagccgcaccgggggtcagtaccggtacggcgatggat
attatggaatcgttagtgaagcagctgccaaacggctttggtctggagtggacggcgatg
tcgtatcaggagcggctttccggcgcgcaggctccggcgctgtacgccatttccttgctg
gtggtattcctgtgtctggctgcgttgtatgaaagctggtcggtgccgttctcggtaatg
ctggtcgtgccgctgggggtaatcggcgcgctgctggcaacctggatgcgcgggctggaa
aacgacgtttacttccaggtgggcctgttaacggtcattggtttatcggcgaaaaacgcc
atcctgatcgtcgagtttgctaacgagatgaaccaaaaaggccacgacctgtttgaagcg
acgctccacgcctgccgtcagcgtttacgcccgattctgatgacctcgctggcatttatc
ttcggcgtattgccaatggcaaccagcacgggtgccggttccggtggtcagcatgcggtg
ggtactggcgtaatgggcgggatgatttcggccactattctggctatttacttcgtgccg
ctgttctttgtgctggtgcgccgccgcttcccgctgaagccgcgcccggaataa

DBGET integrated database retrieval system