KEGG   Escherichia coli K-12 MG1655: b2474Help
Entry
b2474             CDS       T00007                                 

Gene name
tmcA
Definition
(RefSeq) elongator methionine tRNA (ac4C34) acetyltransferase
  KO
K06957  
tRNA(Met) cytidine acetyltransferase [EC:2.3.1.193]
Organism
eco  Escherichia coli K-12 MG1655
Brite
Enzymes [BR:eco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.193  tRNAMet cytidine acetyltransferase
     b2474 (tmcA)
Transfer RNA biogenesis [BR:eco03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    b2474 (tmcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2593844..2595859)
Genome map
AA seq 671 aa AA seqDB search
MAELTALHTLTAQMKREGIRRLLVLSGEEGWCFEHTLKLRDALPGDWLWISPRPDAENHC
SPSALQTLLGREFRHAVFDARHGFDAAAFAALSGTLKAGSWLVLLLPVWEEWENQPDADS
LRWSDCPDPIATPHFVQHLKRVLTADNEAILWRQNQPFSLAHFTPRTDWYPATGAPQPEQ
QQLLKQLMTMPPGVAAVTAARGRGKSALAGQLISRIAGRAIVTAPAKASTDVLAQFAGEK
FRFIAPDALLASDEQADWLVVDEAAAIPAPLLHQLVSRFPRTLLTTTVQGYEGTGRGFLL
KFCARFPHLHRFELQQPIRWAQGCPLEKMVSEALVFDDENFTHTPQGNIVISAFEQTLWQ
SDPETPLKVYQLLSGAHYRTSPLDLRRMMDAPGQHFLQAAGENEIAGALWLVDEGGLSQQ
LSQAVWAGFRRPRGNLVAQSLAAHGNNPLAATLRGRRVSRIAVHPARQREGTGRQLIAGA
LQYTQDLDYLSVSFGYTGELWRFWQRCGFVLVRMGNHREASSGCYTAMALLPMSDAGKQL
AEREHYRLRRDAQALAQWNGETLPVDPLNDAVLSDDDWLELAGFAFAHRPLLTSLGCLLR
LLQTSELALPALRGRLQKNASDAQLCTTLKLSGRKMLLVRQREEAAQALFALNDVRTERL
RDRITQWQLFH
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atggctgaactgactgcgcttcacacattaacagcgcaaatgaaacgtgaagggatccgc
cgcttgctggtgttgagcggggaagagggttggtgttttgagcatactcttaagttgcgt
gatgccttacctggcgactggctgtggatttcgccgcggccagatgctgaaaaccactgt
tctccctcggcactacaaactttacttgggcgcgagttccggcatgcggtattcgacgcc
cgccacggctttgatgccgctgcctttgccgcacttagcggaacgttgaaagcgggaagc
tggctggttttgttactccctgtatgggaagagtgggaaaaccaacctgatgccgactcg
ctgcgctggagtgattgccctgaccctattgcgacgccgcattttgtccagcatctcaaa
cgcgtacttacggcggataacgaggctatcctctggcggcaaaaccagccattctcgttg
gcgcattttactccccgtactgactggtaccccgcgactggcgcaccacaaccagaacaa
cagcaactcttaaagcagctaatgaccatgccgccgggcgtggcagcggtaacggctgcg
cgtgggcgcggtaagtcggcgttggcagggcaactcatttctcgtattgcgggcagagcg
attgtcaccgcgcccgcaaaagcgtcaacggatgtactggcacaatttgcgggcgagaag
tttcgctttattgcgccggatgccttgttagccagcgatgagcaagccgactggctggtg
gtcgatgaagccgcagccatacctgcgccattgttgcatcaactggtatcgcgttttcct
cgaacgttgttaaccactacggtgcagggctacgaaggcaccggacgtggttttttgctg
aaattttgcgctcgctttccgcatttacaccgttttgaactgcaacagccgatccgctgg
gcgcagggatgcccgctggaaaaaatggtcagcgaggcactggtttttgacgatgaaaac
ttcacccatacaccacaaggcaatattgtcatttccgcatttgaacagacgttatggcaa
agcgatccagaaacgccgttaaaggtttatcagctcttgtctggtgcgcactatcggact
tcgccgctggatttacgccggatgatggatgcaccagggcaacattttttacaggcggct
ggcgaaaacgagattgccggggcgctgtggctggtggatgagggtggattatctcaacaa
ctcagtcaggcggtatgggcaggttttcgtcgcccgcggggtaatctggtggcccagtcg
ctggcggcgcacggcaacaatccactggcggcgacattgcgtggacggcgggtcagccgg
atagcagttcatccggctcgtcagcgggaaggcacagggcggcaacttattgctggtgct
ttgcaatatacgcaagacctcgactatctttcggtgagttttggttacaccggggagtta
tggcgtttctggcaacgctgcggttttgtgctggtgcggatgggtaatcatcgggaagcc
agcagcggttgctatacggcgatggcgctgttaccgatgagtgatgcgggtaaacagctg
gctgaacgtgagcattaccgtttacgtcgcgatgcgcaagctctcgcgcagtggaatggc
gaaacgcttcctgttgatccactaaacgatgccgtcctttctgacgacgactggcttgaa
ctggccggttttgctttcgctcatcgtccgctattaacgtcgttaggttgcttattgcgt
ctgttacaaaccagtgaactggcattaccggcgctgcgtgggcgtttacagaaaaacgcc
agtgatgcgcagttatgtaccacacttaaactttcaggccgcaagatgttactggtccgt
cagcgggaagaggccgcgcaggcgctgttcgcacttaatgatgttcgcactgagcgtctg
cgcgatcgcataacgcaatggcaattatttcactga

DBGET integrated database retrieval system