KEGG   Escherichia coli K-12 MG1655: b2480Help
Entry
b2480             CDS       T00007                                 

Gene name
bcp
Definition
(RefSeq) peroxiredoxin; thiol peroxidase, thioredoxin-dependent
  KO
K03564  
peroxiredoxin Q/BCP [EC:1.11.1.15]
Organism
eco  Escherichia coli K-12 MG1655
Brite
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.15  peroxiredoxin
     b2480 (bcp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
2600478..2600948
Genome map
AA seq 156 aa AA seqDB search
MNPLKAGDIAPKFSLPDQDGEQVNLTDFQGQRVLVYFYPKAMTPGCTVQACGLRDNMDEL
KKAGVDVLGISTDKPEKLSRFAEKELLNFTLLSDEDHQVCEQFGVWGEKSFMGKTYDGIH
RISFLIDADGKIEHVFDDFKTSNHHDVVLNWLKEHA
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgaatccactgaaagccggtgatatcgcaccgaaatttagcttgccggatcaagacgga
gaacaagttaatttgaccgacttccagggacagcgtgttctggtttatttctacccgaaa
gccatgacccccggctgtaccgtacaggcctgcggcttacgcgataacatggatgagttg
aaaaaagcgggcgttgatgtgctgggtatcagcaccgataaacccgaaaaactctcccgt
tttgcggaaaaagagctgcttaactttacgctcctgtctgatgaggaccaccaggtgtgc
gaacaattcggcgtctggggtgaaaagtccttcatgggcaaaacctacgatggcattcat
cgcatcagcttcctgattgacgctgatggcaaaatcgaacatgtctttgacgatttcaaa
accagcaatcaccacgacgttgtgctgaactggctgaaagaacacgcctga

DBGET integrated database retrieval system