KEGG   Escherichia coli K-12 MG1655: b2486Help
Entry
b2486             CDS       T00007                                 

Gene name
hyfF
Definition
(RefSeq) hydrogenase 4, membrane subunit
  KO
K12141  
hydrogenase-4 component F [EC:1.-.-.-]
Organism
eco  Escherichia coli K-12 MG1655
Brite
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     b2486 (hyfF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
2606917..2608497
Genome map
AA seq 526 aa AA seqDB search
MSYSVMFALLLLTPLLFSLLCFACRKRRLSATRTVTVLHSLGITLLLILALWVVQTAADA
GEIFAAGLWLHIDGLGGLFLAILGVIGFLTGIYSIGYMRHEVAHGELSPVTLCDYYGFFH
LFLFTMLLVVTSNNLIVMWAAIEATTLSSAFLVGIYGQRSSLEAAWKYIIICTVGVAFGL
FGTVLVYANAASVMPQAEMAIFWSEVLKQSSLLDPTLMLLAFVFLLIGFGTKTGLFPMHA
WLPDAHSEAPSPVSALLSAVLLNCALLVLIRYYIIICQAIGSDFPNRLLLIFGMLSVAVA
AFFILVQRDIKRLLAYSSVENMGLVAVELGIGGPLGIFAALLHILNHSLAKTLLFCGSGN
VLLKYGTRDLNVVCGMLKIMPFTAVLFGGGALALAGMPPFNIFLSEFMTITAGLARNHLL
IIVLLLLLLTLVLAGLVRMAARVLMAKPPQAVNRGDLGWLTTSPMVILLVMMLAMGTHIP
QPVIRILAGASTIVLSGTHDLPAQRSTWHDFLPSGTASVSEKHSER
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgagttattctgtgatgttcgctttactcctgctcacgccgctgcttttttcgctgctc
tgttttgcctgccggaaacggagactttctgcgactcgcacggtgaccgtattacatagc
ttagggatcacactgctgctgattctggcactctgggtggtccaaactgccgctgatgca
ggagaaatattcgctgcgggactgtggcttcatattgatggtctgggcggtttgttcctc
gccattcttggtgtgattggctttctcaccggtatttactcgattggctacatgcgtcat
gaagtggcacacggcgagctttcacccgttacgctgtgcgattactacggtttcttccat
ctgtttttgttcaccatgctgctggttgttaccagcaataacctgattgtgatgtgggcg
gcgatcgaagccaccaccttaagctcggcgtttctggtaggcatttacggtcagcgttca
tcgctggaagctgcatggaagtacatcattatttgtactgttggtgtcgcttttggtctg
ttcggtaccgtgctggtatacgccaacgccgccagcgttatgccgcaggcagaaatggcg
atattctggagcgaggttcttaagcaatcgtccttgcttgacccaacattaatgctgttg
gcctttgtgtttttgctaattggctttggtaccaaaaccgggctatttcccatgcacgcc
tggctgccggatgctcacagtgaagcgccgagtccggtcagcgccctgctctccgccgta
ttgctgaactgcgcgctgttggtgctgattcgctattacatcattatttgccaagccatc
ggcagcgatttccccaaccggttgttgctcatcttcggcatgttgtcggttgccgtggcg
gcatttttcattctggtacagcgggacattaagcgtctgctggcgtactccagcgtggag
aacatggggctggtcgcggtggagctaggcattggcgggccgctgggaatttttgccgcg
ctgctgcacatcttaaaccacagtctggcaaaaacgctgctgttctgcggttccggcaat
gtactgctcaagtacggcacgcgcgatctcaacgtcgtctgtgggatgctcaaaatcatg
ccatttaccgccgtgctgtttggcggcggtgcgctggcgctggcagggatgccgcccttc
aacatttttcttagcgaatttatgaccattaccgccggactggcacgtaatcacctgctg
attatcgtcctgctgttattgctgttaacgctggtgctggcgggcctggtacggatggct
gcgcgggtgttaatggcgaaaccgccgcaggccgttaaccggggtgatctcggctggttg
accacctcgccaatggtgattctgctggtcatgatgctggcgatgggaacgcatattcca
caacctgtcatcaggatcctggcgggcgcttccactatagtcctctcagggacgcacgat
ctgcctgcacaacgtagcacctggcatgattttttgccttcaggcaccgcatctgtttcg
gagaaacacagtgaacgttaa

DBGET integrated database retrieval system