KEGG   Escherichia coli K-12 MG1655: b2488Help
Entry
b2488             CDS       T00007                                 

Gene name
hyfH
Definition
(RefSeq) hydrogenase 4, Fe-S subunit (EC:1.-.-.-)
  KO
K12143  
hydrogenase-4 component H
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
2610164..2610709
Genome map
AA seq 181 aa AA seqDB search
MLKLLKTIMRAGTATVKYPFAPLEVSPGFRGKPDLMPSQCIACGACACACPANALTIQTD
DQQNSRTWQLYLGRCIYCGRCEEVCPTRAIQLTNNFELTVTNKADLYTRATFHLQRCSRC
ERPFAPQKTIALAAELLAQQQNAPQNREMLWAQASVCPECKQRATLINDDTDVLLVAKEQ
L
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagttactgaaaactattatgcgcgccggaaccgcgacggtgaaatatcccttc
gcgccactggaggtcagccctggctttcgcggaaaaccggacctgatgcccagccaatgt
attgcctgcggtgcctgcgcctgtgcttgtccggcaaatgcgctgactatccagaccgac
gaccagcaaaattcgcgcacctggcagctctatctggggcgttgtatttactgcggacgt
tgtgaagaagtgtgcccgaccagagccatccagcttaccaataactttgaactgaccgtc
accaataaagccgatctctatacccgcgcgacgttccatctacaacgttgcagccgttgc
gaacgcccgtttgccccgcaaaaaaccatcgcactggctgctgaattgttagcacagcaa
caaaatgcgccacaaaaccgcgaaatgttgtgggcgcaagcgagcgtctgcccggaatgc
aaacaacgcgcgacgctgatcaacgacgatacagatgtactgctggtggctaaggagcag
ctatga

DBGET integrated database retrieval system