KEGG   Escherichia coli K-12 MG1655: b2491Help
Entry
b2491             CDS       T00007                                 

Gene name
hyfR
Definition
(RefSeq) hydrogenase-4 transcriptional activator
  KO
K12146  
hydrogenase-4 transcriptional activator
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transcription factors [BR:eco03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    b2491 (hyfR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
2611900..2613912
Genome map
AA seq 670 aa AA seqDB search
MAMSDEAMFAPPQGITIEAVNGMLAERLAQKHGKASLLRAFIPLPPPFSPVQLIELHVLK
SNFYYRYHDDGSDVTATTEYQGEMVDYSRHAVLLGSSGMAELRFIRTHGSRFTSQDCTLF
NWLARIITPVLQSWLNDEEQQVALRLLEKDRDHHRVLVDITNAVLSHLDLDDLIADVARE
IHHFFGLASVSMVLGDHRKNEKFSLWCSDLSASHCACLPRCMPGESVLLTQTLQTRQPTL
THRADDLFLWQRDPLLLLLASNGCESALLIPLTFGNHTPGALLLAHTSSTLFSEENCQLL
QHIADRIAIAVGNADAWRSMTDLQESLQQENHQLSEQLLSNLGIGDIIYQSQAMEDLLQQ
VDIVAKSDSTVLICGETGTGKEVIARAIHQLSPRRDKPLVKINCAAIPASLLESELFGHD
KGAFTGAINTHRGRFEIADGGTLFLDEIGDLPLELQPKLLRVLQEREIERLGGSRTIPVN
VRVIAATNRDLWQMVEDRQFRSDLFYRLNVFPLELPPLRDRPEDIPLLAKHFTQKMARHM
NRAIDAIPTEALRQLMSWDWPGNVRELENVIERAVLLTRGNSLNLHLNVRQSRLLPTLNE
DSALRSSMAQLLHPTTPENDEEERQRIVQVLRETNGIVAGPRGAATRLGMKRTTLLSRMQ
RLGISVREVL
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atggctatgtcagacgaggcgatgtttgccccgccacaaggaataacaattgaagcggta
aacggaatgctcgcggagcggttagcacagaaacacggcaaggcgtctttattacgcgcc
ttcatcccgctgccgccgccgttcagcccggtacaacttattgaactgcatgttctcaaa
agcaacttctattaccgctaccatgatgatggcagcgatgtgacggcaacaacagagtat
cagggcgagatggtcgattattcgcgtcacgccgtccttctcggcagtagtggaatggcg
gagctacgctttattcgcacccacggcagtcgttttacttcccaggattgcacactgttt
aactggctggcgcggataatcaccccggttctgcaatcatggctcaatgatgaagaacag
caggtggcgctgcgtttgctggagaaagatcgcgatcatcatcgggtactggttgatatt
actaatgcagtgctgtcacatcttgatctcgacgatctgatcgctgacgtcgctcgtgag
atccatcattttttcggtctggcttcagtcagtatggtactgggcgatcatcgaaagaac
gagaagttcagcctgtggtgcagcgatctttctgcctcacattgtgcgtgtctgccacgc
tgtatgcctggcgaaagtgtattgctgacacaaacgctacaaacccgacaaccgaccttg
acgcaccgtgcagatgatctgtttctctggcaacgcgacccgttattactcttacttgca
tctaacggctgcgaatctgcgctccttataccgcttacctttggcaaccatacaccgggt
gcattgttgctggcgcatacctcttccactctctttagtgaggaaaactgccagctacta
caacacatagccgatcgcatcgctattgccgttggcaatgccgatgcctggcgtagcatg
accgatttgcaggaaagtttgcagcaagaaaaccaccagcttagcgagcagctcctttcg
aatctgggcatcggtgacattatctatcaaagccaggcaatggaagacctgctccagcag
gtagatattgtggcgaagagcgacagtacggtgttgatttgtggtgaaaccggaactggc
aaagaggtgatcgccagagcgatccatcaacttagcccgcgacgcgacaagccgctggtc
aaaatcaactgcgctgccatccccgccagtcttctggaaagtgagttattcggtcatgac
aaaggggcgtttactggtgcgattaatacccatcgtggtcgttttgaaattgccgatggc
ggcacgttgtttctcgatgaaattggcgatctgccgttagaacttcagcctaaactgctg
cgcgtattgcaggagcgggagattgagcgtctcggcgggagtagaacgatcccggtgaat
gtcagagtcattgccgccaccaaccgtgatttgtggcaaatggttgaagatcgccagttt
cgcagcgatctcttttatcgcctgaatgtcttcccactggaattgccgccgctacgcgac
cgtccggaagatatccctcttttagcaaaacatttcacgcaaaaaatggcgcgccatatg
aatcgcgcaattgacgccatcccgaccgaggcactacgccagttgatgtcgtgggattgg
ccgggcaacgtgcgcgagctggaaaacgtgattgagcgggcggtactgttgactcgtggt
aacagtctgaatttacatctaaatgtccgacaaagccgtttactgccgacgctaaatgaa
gattcagcgcttcgcagttcaatggcgcagttactgcacccgacgacgccagagaatgac
gaagaagaacgtcagcgcattgttcaggtattgcgagaaaccaatggcattgttgccggg
ccccgtggcgcagcgacgcgattagggatgaagcgcaccacgctgctgtcacgaatgcag
cggctggggatctcggttcgcgaggtgttgtaa

DBGET integrated database retrieval system