KEGG   Escherichia coli K-12 MG1655: b2492Help
Entry
b2492             CDS       T00007                                 

Gene name
focB
Definition
(RefSeq) putative formate transporter
  KO
K03459  
formate transporter
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b2492 (focB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
2613934..2614782
Genome map
AA seq 282 aa AA seqDB search
MRNKLSFDLQLSARKAAIAERIAAHKIARSKVSVFLMAMSAGVFMAIGFTFYLSVIADAP
SSQALTHLVGGLCFTLGFILLAVCGTSLFTSSVMTVMAKSRGVISWRTWLINALLVACGN
LAGIACFSLLIWFSGLVMSENAMWGVAVLHCAEGKMHHTFTESVSLGIMCNLMVCLALWM
SYCGRSLCDKIVAMILPITLFVASGFEHCIANLFVIPFAIAIRHFAPPPFWQLAHSSADN
FPALTVSHFITANLLPVMLGNIIGGAVLVSMCYRAIYLRQEP
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgagaaacaaactctctttcgacttgcagttgagcgccagaaaagcggcaatcgctgaa
cggattgccgcccataaaattgcccgcagtaaagtgtcggtctttttaatggcgatgtcc
gctggcgtgtttatggcgatcggatttactttttacctttccgttatcgccgatgccccg
tcttcacaggcattaacccatctggtgggcggcctttgctttacactcggctttattttg
ctggcggtttgcggcaccagcctgttcacctcgtcggtaatgacggtgatggcaaaaagt
cggggcgttattagttggcgaacttggctgattaacgcacttctggtggcctgcggtaat
ctggcaggtattgcctgtttcagtttgttaatctggttttccgggctggtgatgagtgaa
aacgcgatgtggggagtcgcggttttacactgcgccgagggcaaaatgcatcatacattt
actgaatctgtcagcctcggcattatgtgcaatctgatggtttgcctggcgctgtggatg
agttattgcgggcgttcgttatgcgacaaaatcgtcgccatgattttgcccatcaccctg
tttgtcgccagtggctttgagcactgtatcgccaatttgtttgtgattccgttcgccatt
gccattcgccatttcgcccctccccccttctggcagctggcgcacagtagcgcagacaat
tttccggcactgacggtcagccattttattaccgccaatctgctcccggtgatgctgggt
aatattatcggcggtgcggtgctggtgagtatgtgttatcgggctatttatttacgtcag
gaaccctga

DBGET integrated database retrieval system