KEGG   Escherichia coli K-12 MG1655: b2495Help
Entry
b2495             CDS       T00007                                 

Gene name
yfgD
Definition
(RefSeq) putative oxidoreductase
  KO
K00537  
arsenate reductase [EC:1.20.4.1]
Organism
eco  Escherichia coli K-12 MG1655
Brite
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.20  Acting on phosphorus or arsenic in donors
   1.20.4  With disulfide as acceptor
    1.20.4.1  arsenate reductase (glutaredoxin)
     b2495 (yfgD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
2617578..2617937
Genome map
AA seq 119 aa AA seqDB search
MTKQVKIYHNPRCSKSRETLNLLKENGVEPEVVLYLETPADAATLRDLLKILGMNSAREL
MRQKEDLYKELNLADSSLSEEALIQAMVDNPKLMERPIVVANGKARIGRPPEQVLEIVG
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaacaggtaaaaatctaccataacccacgctgttcaaagagccgggaaacgctg
aacctgctgaaagaaaacggcgtggagccagaagtggtgctctaccttgagacacccgcc
gatgcggcaacgctgcgcgatttgctgaaaatactggggatgaatagcgcccgtgaattg
atgcgccagaaagaggatctttataaagaactgaacctggctgacagttcgcttagcgaa
gaggcgctgattcaggcaatggtggataatccgaagctgatggagcgcccgattgtggtc
gcgaatggcaaagcgcggattggtcgtccaccggagcaggtactggaaatcgtgggttaa

DBGET integrated database retrieval system