KEGG   Escherichia coli K-12 MG1655: b2504Help
Entry
b2504             CDS       T00007                                 

Gene name
yfgG
Definition
(RefSeq) uncharacterized protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
2629290..2629481
Genome map
AA seq 63 aa AA seqDB search
MSQATSMRKRHRFNSRMTRIVLLISFIFFFGRFIYSSVGAWQHHQSKKEAQQSTLSVESP
VQR
NT seq 192 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcaggcaaccagtatgcgaaaacgacaccgatttaacagtcgcatgacccgtatc
gtactgctcatcagctttatcttcttctttggccgttttatctactcgtccgtcggtgcc
tggcagcaccatcagagcaaaaaagaagctcagcaatccacactctccgtcgaatcaccg
gtacaacgttag

DBGET integrated database retrieval system