KEGG   Escherichia coli K-12 MG1655: b2513Help
Entry
b2513             CDS       T00007                                 

Gene name
yfgM
Definition
(RefSeq) ancillary SecYEG translocon subunit; putative anti-RcsB factor
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_21 TPR_19 T6SS_VasJ TPR_16
Motif
Other DBs
NCBI-GeneID: 946981
NCBI-ProteinID: NP_417008
Pasteur: yfgM
RegulonDB: ECK120003893
ECOCYC: G7321
ASAP: ABE-0008274
UniProt: P76576
Position
complement(2638663..2639283)
Genome map
AA seq 206 aa AA seqDB search
MEIYENENDQVEAVKRFFAENGKALAVGVILGVGALIGWRYWNSHQVDSARSASLAYQNA
VTAVSEGKPDSIPAAEKFAAENKNTYGALASLELAQQFVDKNELEKAAAQLQQGLADTSD
ENLKAVINLRLARVQVQLKQADAALKTLDTIKGEGWAAIVADLRGEALLSKGDKQGARSA
WEAGVKSDVTPALSEMMQMKINNLSI
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
gtggaaatttacgagaacgaaaacgaccaggtagaagcggttaaacgcttttttgctgaa
aatggcaaagcactggctgttggggtgattttgggcgttggcgcactgattggctggcgc
tactggaacagccatcaggttgattctgcacgctccgcttctcttgcctatcaaaatgcg
gttaccgcagtgagcgaaggcaaaccggatagcatcccggcggcggaaaaatttgctgct
gaaaataaaaatacttatggtgcgctggcttctttggaacttgcgcagcaatttgttgac
aaaaatgaactagagaaagctgccgcccagttacaacaggggctggcagacacgagcgat
gaaaatctcaaagccgtgataaatctgcgtcttgctcgcgttcaggtacagctcaagcag
gctgatgccgcgctgaaaacccttgataccatcaaaggtgaagggtgggctgccattgtt
gccgacctgcgtggtgaagcattgctgagcaaaggtgataagcaaggtgcgcgtagtgca
tgggaagcaggcgtgaaaagcgatgttactccggcactgagcgaaatgatgcagatgaaa
attaataatttgtccatctga

DBGET integrated database retrieval system