KEGG   Escherichia coli K-12 MG1655: b2516Help
Entry
b2516             CDS       T00007                                 

Gene name
rodZ
Definition
(RefSeq) MreB assembly cytoskeletal protein
  KO
K15539  
cytoskeleton protein RodZ
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(2641831..2642844)
Genome map
AA seq 337 aa AA seqDB search
MNTEATHDQNEALTTGARLRNAREQLGLSQQAVAERLCLKVSTVRDIEEDKAPADLASTF
LRGYIRSYARLVHIPEEELLPGLEKQAPLRAAKVAPMQSFSLGKRRKKRDGWLMTFTWLV
LFVVIGLSGAWWWQDRKAQQEEITTMADQSSAELSSNSEQGQSVPLNTSTTTDPATTSTP
PASVDTTATNTQTPAVTAPAPAVDPQQNAVVSPSQANVDTAATPAPTAATTPDGAAPLPT
DQAGVTTPVADPNALVMNFTADCWLEVTDATGKKLFSGMQRKDGNLNLTGQAPYKLKIGA
PAAVQIQYQGKPVDLSRFIRTNQVARLTLNAEQSPAQ
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaatactgaagccacgcacgaccaaaatgaagcacttactaccggcgctcgcctgcgt
aatgctcgcgaacaactaggacttagtcagcaggccgttgccgagcgactttgcctgaag
gtttccacggtacgcgacattgaagaagataaggcacccgccgatcttgcttcaacattc
ctgcgcggatatatccgctcttatgcgcgtctggtacatattccagaagaagaactgctg
ccagggctggaaaagcaggctccacttcgggctgcaaaagttgcgccgatgcagagtttt
tccctcggtaaacgccgcaaaaaacgcgacggctggctgatgaccttcacttggctggtg
ttgtttgtggttatcggcctgagcggtgcctggtggtggcaagaccgcaaagctcagcag
gaagagatcaccactatggccgatcaatcttcggcggaactgagcagtaatagcgagcag
gggcagagtgttccattaaatacgtcgacaactacagacccggctacaacgtccacgccg
ccagcgtctgtggatactaccgcaaccaacacgcaaacacctgccgtaactgcgccagca
ccagctgttgatccgcaacagaatgcggttgtttcgccttcgcaggcaaatgttgatacc
gccgcgaccccggcaccaacggcagcaacaacgccagatggtgctgcgccgttgccaacc
gatcaggctggcgtgaccacgccggtggctgatccgaatgcgctggtgatgaactttact
gccgattgctggctggaggtcactgatgctaccggtaaaaaattgtttagcggtatgcag
cgtaaagacggtaatttgaacttaaccggccaggcaccgtacaaactgaaaattggtgcg
ccagccgcagtacagatccagtatcaagggaaacctgtcgatctgagtcgttttatcaga
actaaccaggttgcgcgtctgaccctcaatgccgaacaatcaccggcgcagtaa

DBGET integrated database retrieval system